Tag: "targets" at biology news

Blood test shows promise as monitor for antiangiogenic cancer therapy

... for such therapies. Antiangiogenic cancer therapy targets the formation of new blood vessels used to support tumor growth. Although many of these agents are currently being tested in clinical trials, no reliable way to monitor the effects of many, if not most, of these therapeutic agents on the inhibition o...

Researchers find how protein allows insects to detect and respond to pheromones

...suggest that olfactory binding proteins may be new targets for synthetic chemicals that could trick insects l...different species. We think that OBPs might be new targets for insect control and repellents." Other studies have also linked OBPs to insect behavior. A 2002 f...

New, automated tool successfully classifies and relates proteins in unprecedented way

...ns a new way to identify disease proteins and drug targets by helping to show which proteins cluster together inside a cell. The approach, developed by Carnegie Mellon University, outperforms existing visual methods to localize proteins inside cells, says Professor Robert F. Murphy, whose report appears in ...

Study provides insights on why some prostate cancer becomes resistant to hormone withdrawl therapy

...r mutant forms of the receptor should be potential targets for new drugs that will be particularly effective in men whose cancers have these mutations and related events," he said. Because androgen deprivation has numerous side effects--including bone loss and sexual dysfunction--drugs that specifically atta...

Protein tyrosine phosphatases to be topic of ASBMB-Merck Award lecture

...perfamily. Like many other tumor suppressors, PTEN targets proteins in signaling pathways that regulate cell growth and apoptosis. Dr. Dixon has brought a strong chemical background and expertise in molecular biology and molecular genetics to his research investigations. Early in his career, he was a leader...

Protein stops growth of brain tumor, OHSU study shows

...wth in a subset of glioma. "We found our inhibitor targets the full-length EGF receptor, but not the mutant EGF receptor," Clinton said. "So a patient with a glioma generated by the mutant EGF receptor would not be expected to respond to herstatin." She added, "This inhibitor we have is a naturally occurring...

Bioartificial kidney under study at MCG

... perform their endless task, which makes them easy targets in the ICU, Dr. Szerlip explains. As examples, kidneys can become ischemic and begin to fail if blood pressure drops because of a long surgery with significant blood loss. Infection can further reduce blood flow to the kidneys. Ironically, some antib...

New nicotine-like imaging agent holds promise in PET studies, may help diagnose Alzheimer's disease

...havioral and addictive actions, and, by looking at targets in the brain where nicotine acts, researchers hope to address several major health problems, said SNM member Jogeshwar Mukherjee, Ph.D., associate professor in residence at the department of psychiatry and human behavior, Brain Imaging Center, at the...

JCI table of contents

...diated by the smallpox growth factor (SPGF). SPGF targets the erbB-1 signaling molecule, which normally initiates an intracellular cascade that facilitates viral replication. This study shows that drugs that interfere with erbB-1 signaling inhibit SPGF-induced viral replication and spread. The authors sh...

Stopping smallpox in its tracks: A new anti-viral approach

...diated by the smallpox growth factor (SPGF). SPGF targets the erbB-1 signaling molecule, which normally initiates an intracellular cascade that facilitates viral replication. This study shows that drugs that interfere with erbB-1 signaling inhibit SPGF-induced viral replication and spread. The authors sh...

Key trigger of opioid withdrawal symptoms found

...urotransmitter transporters may prove to be useful targets for management of opioid dependence," they wrote. The researchers also wrote that, since GABA is a neurotransmitter that inhibits nerve impulses, drugs to inhibit the GABA transporter "could produce their therapeutic effect through altering extracell...

Research using mouse models reveals a novel key player in the initiation of colon cancer

...n the APC gene, mutations in the Foxl1 gene or its targets may dramatically increase the likelihood that the second normal copy of the APC gene is lost or mutated, leading to the initiation of tumor formation. This study sets a new paradigm for gastrointestinal tumorigenesis, in that genetic events outsid...

Effective cancer treatments follow the clock

...lock affects the survival of immune cells that are targets of the anti-cancer drug cyclophosphamide (CY). "We became interested in examining this issue because there is a long history of knowledge that chemotherapeutic agents produce different mortality and morbidity at different times of the day," said Taka...

Scientists discuss improved biopesticides for locust control in West Africa

...hogen of locusts and grasshoppers. It specifically targets those insects and does not affect non-target organisms," Vaughan said. "The persistence of base biopesticides is low in the environment because of degradation from sunlight," Agblevor said. "We have developed coating technologies to improve on the en...

Circles of DNA might help predict success of stem cell transplantation

...ve been converted to parent T cells--each of which targets a specific foreign substance, according to Rupert Handgretinger, M.D., Ph.D., director of Stem Cell Transplantation at St. Jude and co-director of the Transplantation and Gene Therapy Program. "sjTRECs appear only after the gene shuffling has succ...

When does a mole become a melanoma?

...hese genes may lead us to excellent pharmaceutical targets for treatment of melanomas," Zon says. Once these targets are identified, the zebrafish can be used to test potential anti-melanoma drugs that hit the targets...

Fritz Lipmann lecture will look at enzyme biosynthesis of peptide natural products

...s pathways for antibiotic synthesis, the molecular targets of antibiotic action, and the mechanisms of antibiotic resistance, but also serves as a platform for the synthesis of novel antibiotics. Dr. Walsh is also an accomplished mentor who has provided rigorous and insightful training for many younger scien...

Joslin scientists show knocking out two key signals will cause diabetes

...ers to turn off specific signals with a virus that targets specific cell types with a kind of RNA that would interfere with the liver cells' ability to make IRS-1 or IRS-2. The liver is the focus of considerable diabetes research because it is a major controller of metabolic functions, including those that r...

The shapes of life

... function in many life processes and could lead to targets for the development of new medicines. The PSI is ...ct the shape of unknown proteins, quickly identify targets for drug development, and compare protein structures from normal and diseased tissues." In general, ...

Research focusing on why estrogenic hormones produce differing results

... hope to the idea that new drugs might reach their targets and work more effectively. Ultimately it could me...o do is develop a hormone drug -- a ligand -- that targets exactly the tissues you want to affect without affecting any others." Such work is already beginning...

1 2 3 4 5 6 7 8 9 10

(Date:11/12/2014)... 12, 2014 Crossmatch™, a leading provider of ... ® fingerprint readers have been deployed throughout Montparnasse ... Central Mexico . The bakery chain implemented the ... issues caused by employees clocking in for each other. ... readers, Montparnasse relied on paper timecards and a mechanical ...
(Date:11/7/2014)... Dr. Debra Auguste, associate professor, biomedical engineering, in ... College of New York, have identified a molecule ... of the most aggressive forms of breast cancer. ... high mortality rate owing to aggressive proliferation and ... However, Professor Auguste,s team, discovered the overexpression of ...
(Date:11/6/2014)... groundbreaking paper from a team of Florida State University ... plants could adapt to and survive environmental swings such ... the latest issue of the journal The Plant ... of DNA and proteins) is organized in a cell ... genes are turned on and others are turned off. ...
Breaking Biology News(10 mins):Montparnasse Pasteleria Achieves Time and Attendance Transparency with Crossmatch U.are.U Fingerprint Readers 2Maize analysis yields whole new world of genetic science 2
Other Tags
bloomduecorpsesmellyvalvesimplifyarisingschrenkinsurancecirrhosiscelecoxibtooculpritfindresearchersstanford