Tag: "tau" at biology news

Potent anticancer drug increases function of axons in mouse model of neurodegeneration

...xceed helps correct the problems caused by clumped tau proteins in the nerve cells of mice. "Our hope is ...so wanted to find a drug that replaces the clumped tau in sick neurons." Microtubule-binding drugs derived from plants (taxol) and other biological organis...

Hopeful results from interrupted Alzheimer's vaccine study

... also had a decrease in levels of a protein called tau in their spinal fluid, compared with participants ...ponders had a significant decline in levels of the tau protein, a structural protein considered a hallmark of cell death in the brain, when compared with 1...

APNS sees abnormal cell division as possible precursor of Alzheimer's disease

...another possible cause: abnormalities occurring in tau proteins that may activate a cascade of abnormal events. All of this takes place long before clinical symptoms of Alzheimer's are apparent."...

Scientists discover that three molecules may be developed into new Alzheimer's drugs

...e, called CDK5, that attaches the phosphate to the tau protein, facilitating the disease process. The res... laboratory, they purified the enzyme and purified tau protein, and watched tau get phosphorylated by the enzyme. They then performed a library search of s...

Astronomer announces shortlist of stellar candidates for habitable worlds

...tions. This star is part of a triple star system. tau Ceti Unlike the candidates in this group, Tau Ceti is a G-class star, the same brightness category as our Sun. Metal-poor compared to the Sun but long-lived enough for complex life forms to evolve. Turnbull acknowledges that it is a toss up when it...

New research shows Pin1 enzyme is key in preventing onset of Alzheimer's disease

...stablish a direct link between amyloid plaques and tau tangles, the two abnormal structures that are cons... for memory would collapse under the weight of the tau protein tangles, ultimately leading to age-dependent neurodegeneration. In this new study, Lu and hi...

A sweet solution for Alzheimer's disease?

...loid aggregate into plaques, and a protein called tau clumps into neurofibrillary tangles. The brain bec...e," St George-Hyslop said. The mice do not develop tau tangles, he explained, but they are prone to amyloid plaques, brain inflammation, cognitive disturba...

Tips from The Journal of Neuroscience

...accumulation of the microtubule-associated protein tau is associated with several neurodegenerative disea...mentia with parkinsonism-linked to chromosome 17), tau mutations are sufficient to produce neurodegeneration. This week, Dickey et al. focused on the role ...

A surprise about our body clock

... Arbor. The study which involved the so-called tau mutation that causes hamsters to have a 20-hour da...overed that what was previously believed about the tau mutation that a decrease in gene activity sped up a mammal's internal clock was incorrect. Instead...

Researchers find cause of frontotemporal dementia

...chromosome 17. Chromosome 17 is the carrier of the tau protein's hereditary code, and defects in this pro...U). Patients with FTDU do not have a defect in the tau protein, but in another protein in chromosome 17. Christine Van Broeckhoven's research team has now ...

Untangling a pathology of Alzheimer's

...snips apart the abnormal tangles of protein called tau that are associated with cognitive decline and neu... in mice engineered to have a mutant form of human tau that causes neurodegeneration. Such microarrays enable researchers to determine the activity of thou...

Complaints about memory are associated with Alzheimer-related brain damage

...ly looked at was the amount of amyloid plaques and tau tangles in the brain at the time of death. These plaques and tangles are the type of damage most closely linked to Alzheimer's disease. The researchers found that each unit of Alzheimer-related pathology was associated with one point higher score o...

Targeting tau: Inflammation study suggests new approach for fighting Alzheimer's

...recede the formation of tangles twisted fibers of tau protein that build up inside nerve cells a hallma...the inflammation caused by the accumulation of the tau protein might be a new therapy for treating neurodegenerative disorders," says senior author Virgini...

Scientists identify 'missing link' in process leading to Alzheimer's disease

...ed mammalian cells that either did or did not make tau to study how cells respond to beta-amyloid. They f...but not fibrillar beta-amyloid works together with tau to break apart microtubules highways along which "synapse" replacement parts move rapidly in the ne...

JCI table of contents: February 15, 2006

... AD is the abnormal accumulation of phosphorylated tau (p-tau) proteins resulting in the formation of neu...p90 inhibitor, EC102, to mice overexpressing human tau caused a significant reduction in p-tau levels. The findings point to a pivotal role for Hsp90 in ...

News tips from the Journal of Neuroscience

...tein modifications that might link homocysteine to tau and amyloid precursor protein (APP). Heres their r...ting PPMT. In these same cells, phosphorylation of tau and APP was enhanced. In mice prone to high homocysteine levels, a high-methionine, low-folate diet ...

News tips from the Journal of Neuroscience

...al cell membranes. 3xTg-AD mice that exhibit A and tau pathology showed decreases in soluble A as well as reductions in tau levels after 3 months of diet supplementation. Reductions of A and tau were less striking after 6 an...

Omega-3 fatty acid may help prevent Alzheimer's brain lesions

...e test groups had lower levels of beta amyloid and tau than mice in the control group, but at nine months, only mice on the DHA diet had lower levels of both proteins. These results suggest that DHA works better on its own than when paired with omega-6 fatty acids. The scientists also determined the m...

Scientists identify new strategy for preventing acute and chronic brain disease

...ave discovered that reducing levels of the protein tau can prevent seizures and neurological deficits rel...oday in the journal Science, demonstrate that when tau is removed from mice genetically engineered to simulate Alzheimer's disease, their memory function i...

Story ideas from the Journal of Biological Chemistry

...ks is the abnormal aggregation of a protein called tau within nerve cells. Scientists have long suspected... testing this hypothesis in cultured cells because tau proteins do not aggregate easily under normal conditions. To address this problem, Jeff Kuret and ...

1 2

(Date:10/16/2014)... Post-menopausal women experienced improvements in vaginal atrophy, with ... bleeding, after 12 weeks of daily 10 milligram ... nutritional supplement previously shown to help relieve certain ... study reported in a poster at the North ... , "These data documented improved vaginal epithelium, without ...
(Date:10/15/2014)... has admitted Johannes Gutenberg University Mainz (JGU) as ... hub continues to maintain a significant nationwide standing ... "The acceptance of Johannes Gutenberg University Mainz as ... milestone in the national and international competition for ... of Rhineland-Palatinate can be proud that Mainz University ...
(Date:10/15/2014)... 15, 2014   Neurotechnology , a provider ... availability of the VeriLook Surveillance 3.0 software ... real-time biometric face identification using live video streams ... The new version not only identifies faces in ... objects while they are moving through the video ...
Breaking Biology News(10 mins):S-equol supplements associated with improved measures of reproductive health in postmenopausal women 2Johannes Gutenberg University Mainz joins Germany's Gauss-Allianz as a full member 2Johannes Gutenberg University Mainz joins Germany's Gauss-Allianz as a full member 3VeriLook Surveillance 3.0 SDK Identifies Faces and Moving Objects, Differentiates Pedestrians from Other Moving Objects in Video Surveillance Systems 2VeriLook Surveillance 3.0 SDK Identifies Faces and Moving Objects, Differentiates Pedestrians from Other Moving Objects in Video Surveillance Systems 3
Other Tags
doublecortindirectingpayloadsstsmaintenancetelomerealivedrunkenapplesdevicewidelyisraeliimpactmonitoringneurodegenerativeions