Tag: "them" at biology news

NIH awards new $14.5 million, five-year grant to the Scripps Research Institute

... using these transporters, and bacterial cells use them to resist antibiotics. In 2002, the Stevens lab...s, amino acid building blocks, and enzymesand puts them all together in a test tube under conditions that favor expression. In vitro expression has been ...

Don't stand so close to me: A new view on how species coexist

...shoulders too closely because evolution has caused them to compromise on key life measures, say ecologists...multi-celled species. Their 200,000 species places them approximately next to land plants in terms of diversity. To their surprise they found that over long...

US researchers show cottonseed drug is cancer treatment booster

...roteins are over expressed in many cancers, making them resistant to drug and radiation treatment. So, it is not just prostate cancer that our findings are relevant to, but also other cancers with BcL-2/xL expression, such as those of the lung, breast, ovary, pancreas, skin, brain and head and neck, where...

32 new grants made for innovative technology R&D

...e of withstanding harsh environments and integrate them in a wireless telemetry system to enable thermal, mechanical and wear sensing in operating gas turbines for condition-based maintenance. Spry Learning Company (Portland, Ore.) Technology for Early Detection and Intervention of Cognitive Decline...

Commandeering cellular machinery: recognition mechanism to detect small molecules

...les, scientists have been attempting to understand them and solve their molecular structures with a goal of creating pharmaceuticals able to turn them off or on. The research often involves placing nuclear receptors into yeast cells, which because th...

Of lice and men

... human. We either battled with them, or lived with them or even mated with them. Regardless, we touched th...in Europe, it was suspicious that our contact with them immediately preceded their extinction," Reed says. "Our study has provided evidence that we had cont...

Offspring at risk from maternal occupational exposure to solvents

..., but they all share chemical properties that make them easily inhaled and they can easily penetrate skin. Work environments where solvents are used include manufacturing and industry jobs involving painting and plastic adhesives, nail salons, dry-cleaning operations, and medical laboratories. "Reducing e...

Columbia University scientist wins 2004 Nobel Prize

...neurons converge in the olfactory bulb, which gave them further insights into how smell is processed in the brain. Each olfactory receptor cell possesses only one type of odorant receptor, and each receptor can detect a limited number of odorant substances, so the olfactory receptor cells are highly spec...

Fungus knocks a frog down but not out, raising questions about amphibian declines

...ralia several species crashed to extinction, among them the Northern Gastric Brooding Frog, which lived in the same environment as T. eungellensis." Retallick said. T. eungellensis populations crashed but survived in remnant colonies totaling about five percent of the original population. The decl...

HHMI researchers Richard Axel and Linda Buck win 2004 Nobel Prize

...ss-cross the cell surface seven times, which gives them a characteristic, snake-like shape. They also func... the genes in 1991, I couldn't believe it! None of them had ever been seen before. They were all different but all related to each other. That was very sati...

How roots control plant shoots

...oducing abundant leaves in a drought by irrigating them while overriding the genetic signal that normally would inhibit growth, Sieburth says. The new study was published in the Oct. 5 issue of the journal Current Biology by Sieburth, graduate student Jaimie Van Norman and Rebecca Frederick, who formerl...

New Stanford center probes nanoscale material

...er companies to develop novel nanoprobes and apply them to answering fundamental questions in science and ...By the time [students] reach high school, a lot of them have already turned off [to science]," Moler said. The center is interdisciplinary, with faculty fro...

Pine cones lead to a fundamental change in clothing

...omimetics, which takes ideas from nature and turns them into new technology. Its head, Professor Julian Vincent, said: "The new smart clothing will make wearers' lives much more comfortable by automatically adjusting their clothing to control their body temperature. "We've all known days when ...

Intelligent clothing inspired by pine cones

...omimetics, which takes ideas from nature and turns them into new technology. Its head, Professor Julian Vincent, said: "The new smart clothing will make wearers' lives much more comfortable by automatically adjusting their clothing to control their body temperature. "We've all known days when the weather ...

Does a time delay between prostate cancer diagnosis and start of radiation treatment matter?

...patient, and physicians have limited data to guide them regarding the urgency of treatment. "The purpose of this study was to evaluate the effect of treatment delay on the outcome of these men who choose external-beam radiation," Andrews said. The study looked at data for 1,498 patients treated with exter...

'Immediately open access' option for the leading journal Genome Research

... added, "It is clear that some scientists, many of them active in the genome science community, are personally committed to the philosophy of open access and have the resources to support the 'author-pays' model of publication charges. By making the immediately open accessoption available, Genome Research...

University of Edinburgh hosts European conference on childhood disability

...to optimising children's environment by protecting them against emotional abuse. Delegates will discuss how we as professionals can make best use of our own learning in order to offer disabled children the most effective help. The conference should point the way forward for us to promote and extend resear...

Researchers find chemosignal that encourages women's sexual desire

... set of pads on a regular basis and asked to swipe them under their noses in the morning and at night and any other time of the day in which they may have wiped their upper lips, showered or exercised. The women with partners were asked about their moods and were asked to complete daily a survey ...

After flu exposure, mild exercise protects mature mice from dying

...e after they were infected with influenza protects them from dying, compared with mice that didn't exercise. This protective effect was more evident in mice greater than 16 weeks of age, an age at which they are immunologically more mature. The takeaway message: exercise regularly because you never know w...

Interactive health information system to detect Japanese encephalitis in Asia

...th officials need surveillance networks that allow them to respond quickly to reported cases and readily identify outbreaks. Voxiva has developed a phone- and web-based information system that uses existing communications infrastructure (e.g. mobile, pay and land-based phones). Health workers can use any ...

1 2 3 4 5 6 7 8 9 10

(Date:5/22/2013)... (NLST) investigators also conclude that the 20 percent ... tomography (LDCT) versus chest X-ray (CXR) screening previously ... at experienced screening centers in the United States. ... with their patients about the benefits and risks ... in the New England Journal of Medicine ...
(Date:5/22/2013)... Harvard physicists have developed a novel technique that can ... a process that is one of the most important, ... described in a paper in Nature , post-doctoral ... Dr. Melanie Schnell of the Center for Free-Electron Laser ... relies on finely-tuned microwave fields to identify molecular variants ...
(Date:5/22/2013)... Md. (May 22, 2013)The omega 3 fatty acids in ... cardiovascular diseaseso much so that the American Heart Association ... a week, particularly fatty varieties rich in omega 3s. ... a mystery. In a new study, scientists led by ... on this phenomenon by providing evidence that fish oil ...
Breaking Biology News(10 mins):NLST: CT detects twice as many lung cancers as X-ray at initial screening exam 2NLST: CT detects twice as many lung cancers as X-ray at initial screening exam 3Detecting mirror molecules 2Detecting mirror molecules 3Fish oil may help the heart beat mental stress 2
Other Tags
reversiblyswitchesmitslittlerappliesspecificityforeveraustraliansrelyfeversovertakemortemscarspresentingpodcastcore