Tag: "through" at biology news

Reassuring findings from first study on sperm donor identification

... experiences of adolescents who had been conceived through 'open-identity' sperm donors, US researchers found... reflect the intentions of the actual youths going through the identity-release process." Dr Scheib said that the practice of open-identity sperm donation was ...

Gene exchange between species is aided by parasitism

...uggests Plantago weeds acquired the defective atp1 through horizontal transfer recently -- not more than a few million years ago. The dodders' manner of attacking plants suggests a way DNA could have traveled between parasite and host, the IU scientists say. As part of their parasitism, dodder cells penetra...

Joslin and Stanford researchers find key clues to muscle regeneration

...ford. Funding for this study was provided in part through grants from the National Institutes of Health, the Department of Veterans Affairs, and the Burroughs Wellcome Fund....

Researchers discover molecular timekeeper in bone development

...o thrive. Backtracking through the bone-formation process, they discovered that the defect was in the earliest steps, where the cartilage foundation was being laid and filled with minerals. Before the foundation was complete, minerals were being deposited too soon, allowing bone t...

Extinction in ocean's mud presages key ecological changes

...data on each species' size, abundance and movement through the mud, it is possible to construct mathematical models to predict the ecological consequences of losing species, according to Cardinale. Running the models, the group found that the extinction of species is generally expected to reduce the am...

Duchenne Muscular Dystrophy research focuses on early mechanisms

...reducing the risk of microtrauma to muscle tissues through better nutrition and exercise regimes; understanding the role of post-exercise nutrient consumption on muscle protein metabolism and lean tissue gain; and understanding the short- and long-term effects of exercise, inactivity and disease on the funct...

By impounding iron, FHC foils cell suicide, fuels inflammation

... to eliminate excess or damaged cells. Each year, through a balance of cell death and cell division, humans ...his pathway, it has become realistic." NF-kB acts through one subset of genes to influence immunity and a different subset to cause programmed cell death. To ...

UCSD researchers find effective treatment for unusual fever syndrom caused by cold exposure

...e found a similar story that had been passed along through the years. "One older family member told me that the disease started with his great-great-great-great grandfather who was working on a farm during a hot day, and he fell into cold water," Hoffman said. "Then, at another reunion, someone else w...

Automated scans let scientists track drugs' broad effects on cells

...ological profiles look similar, they probably work through similar mechanisms," Altschuler says. "It's particularly useful for understanding drug action because it allows us to look at many concentrations of a drug, which is essential for comparing two drugs that may have different potency but act on the sam...

New study links low fish supply to increased bushmeat hunting

...ermarket and told you that you wouldn't need to go through the cashier," he said. "Of course, people wouldn't go to the potatoes; they'd go to the meat department." Moreover, the fish caught by foreign fleets do nothing to benefit the local African economy because they're taken to Europe for ...

Tropical birds sensitive to environmental cues that can be impacted by global warming

...-bird mating processes. Moore's research is funded through fellowships and grants from the Society for Neuroscience and the National Science Foundation....

Avian cholera could spread from Great Salt Lake

...irds. As a result, avian cholera can sweep quickly through a wetland and kill thousands of birds in a single outbreak. Avian cholera outbreaks occur primarily in winter and early spring. During these times, waterfowl are usually in dense groups on wintering or staging areas and may be experiencing stress du...

NIEHS to develop new RNAi library to help fight disease

...l develop a new RNAi library to help fight disease through its National Center for Toxicogenomics. RNAi, or RNA interference, is a new technology which silences specific genes. RNAi technology "turns off" specific genes so scientists can learn more about how the genes influence the cell. Knowing how a gene ...

Academy eBriefings offer comprehensive reports on more than 100 cutting-edge scientific issues

... now reaching thousands. Conveying the information through science journalists, many of whom have had former lives at the lab bench, rather than needling our speakers for write-ups of their talks, has been a breakthrough both in terms of timeliness and readability. And of course, providing the option of lis...

Genetic influences on taste perception of alcohol may influence alcohol intake

...8 genotype and alcohol intake is probably mediated through the bitterness of PROP," she said. "In other words, the present study suggests another genetic mechanism that may mediate alcohol use based on oral sensory influences." However, she added, these results were found in light to moderate drinkers, and...

New findings may redirect strategies for treatment of prostate cancer

...dependent modulation of androgen receptor function through effects on DNA binding and stability" ...

Nuclear imaging offers possibility for early detection of patients with coronary heart disease

...f plaque build up that can block the flow of blood through an artery, according to journal reports published by the Society of Nuclear Medicine. A trio of articles, "Evaluation of 18F-FDG Uptake and Arterial Wall Calcifications Using 18F-FDG PET/CT," "Molecular and Metabolic Imaging of Atherosclerosis" and...

Small seasonal changes can lead to big flu outbreaks

...tigate and understand how infectious diseases move through populations, recently examined the question of why...level are greatly amplified as the disease spreads through communities. The underlying cause of seasonal fluctuations in transmission may be too small to meas...

Clemson professor receives award

...s more than 20 years of experience in kindergarten through grade 12 (K-12) science education, curriculum deve...environmental awareness education for youth either through educating other instructors or by working with community groups and K-12 programs. "I am hono...

Army-funded effort examines androgen's role in bone loss

...its, is funding a four-year, $1.72 million project through the Department of Defense Peer Reviewed Medical Re...rosis in men and women is androgen therapy, either through androgen replacement using hormone drugs, or androgen replacement combined with estrogen replacement...

1 2 3 4 5 6 7 8 9 10

(Date:5/16/2013)... to Research Careers) Program has announced the travel ... Annual Meeting in San Francisco, CA from June ... the entry of students, postdoctorates and scientists from ... science community and to encourage the participation of ... , Awards are given to poster/platform presenters and ...
(Date:5/16/2013)... ancient shorelines to predict the stability of today,s largest ice ... from three million years ago, for example when Earth ... be evidence of a high sea level due to ice ... scientists to think that if the world,s largest ice sheets ... same in our modern, progressively warming world. , However, ...
(Date:5/16/2013)... cellular layer lining the body,s blood vessels, is ... in thickness, this super-tenuous structure routinely withstands blood ... create a unique and highly dynamic barrier that ... the body,s circulatory system. , It,s also extremely ... physically breached to enable immune cells to ...
Breaking Biology News(10 mins):World's biggest ice sheets likely more stable than previously believed 2Endothelium, heal thyself 2Endothelium, heal thyself 3Endothelium, heal thyself 4
Other Tags
manageradoptionhysteriagrapplingbrewsphysicistsmillipedescavemassesremovingcompletelyappropriatewiperelativelycursorsmalarial