Tag: "tips" at biology news

Urine helps infectious yeast stick

...specific other proteins attach themselves near the tips of chromosomes, obscuring the nearby genes," says ...s adhesion-promoting genes are near the chromosome tips and are usually silenced by this process. In yeast missing Sir3, the EPA genes were exposed and used...

Elizabeth Blackburn and Janet Rowley awarded

...stigating the structure and role of telomeres, the tips of genetic material at the end of chromosomes. Prior to her work, all that was known about telomeres (from the Greek word for 'end' and 'part') was that they became shorter with each cell division and, by implication, served as a kind of biological c...

Biochemists report discovery of structure of major piece of telomerase; implications for cancer

...ell divides, telomeres, which act like the plastic tips on the ends of shoelaces, get shorter. In the natural aging process, the telomeres eventually get so short that cells can no longer divide, and they die. While telomerase is turned off in most types of healthy cells in our bodies, it is active in the...

Gorilla diet tips -- Have we 'evolved to eat mush'?

...ncestors' lifestyles may not provide concrete diet tips for today's weight-conscious humans. But, he said, we may gain fundamental insights to our origins, and thus, our behaviors, by investigating the fossil record. The results of a nine-year field study of mountain gorillas living with chimps in Uganda...

Progress toward a new remedy for chronic urinary tract infections?

...eaction between the protein 'Adhesine FimH' on the tips of the pili and special receptors on the wall of the urinary tract. The researchers hypothesized that they could prevent this binding by administering a substance that would have a greater affinity with Adhesine FimH than with the receptors on the ur...

'Moss in space' project shows how some plants grow without gravity

...d from where they were originally sown. Later, the tips of the filaments grew in arcs so that the entire culture showed clockwise spirals. The same patterns were found when the moss was grown on a clinostat on the ground. Even with the limited data from STS-107, 10 of the 11 salvageable moss cultures show...

Dietary Guidelines Alliance offers tools to help consumers understand new nutrition guidance

...ple cut through the clutter and provide motivating tips so they can adopt the new guidelines in their live... Guidelines for Americans. The It's All About You tips that were developed by consumers for consumers include: Be Realistic: Make small changes in what ...

A clear view of mycobacterial infection

...o their advantage, but it remains to be shown what tips the balance between the macrophages' ability to clear the infection and their unwitting participation in the development of TB....

Channel protein converts vibrations to electrical signal

...e, a fluorescently-tagged TRPA1 antibody bound the tips of the cilia, where the mechanically activated channels were known to be located. This localization of TRPA1 changed, however, when the researchers treated the hair cells with a chemical that damages the mechanically-sensitive signaling pathway. Oth...

New Stanford center probes nanoscale material

...tions between the tip and their samples and design tips optimized for specific applications. Calvin Quate (Applied Physics), co-developer of the AFM with IBM's Gerd Binnig and Christoph Gerber, will consult with students and faculty on issues related to the conception, design and fabrication of cantilever...

1 2 3 4

(Date:6/17/2013)... CORVALLIS, Ore. Amphibian populations are declining worldwide and ... be spread by bullfrogs, but a two-year study shows ... suggestions that bullfrogs are a tolerant carrier host that ... frogs from eggs in controlled experimental conditions, they found ... dendrobatidis , also called Bd or a chytrid fungus, ...
(Date:6/16/2013)... prevention programs for female sex workers in India reduce ... (STIs), a University of Toronto study has found. ... HIV, mostly in the southern states of Andhra Pradesh, ... Professor Prabhat Jha from U of T,s Dalla Lana ... for Global Health Research (CGHR), examined the impact of ...
(Date:6/16/2013)... ago triggered a similar marine ecosystem crisis to those ... warming, according to research published today in Nature ... universities of Newcastle, UK, Cologne, Frankfurt and GEOMAR-Kiel, confirms ... the marine ecosystem during the mid-Cretaceous greenhouse period. ... amplitude and duration of the temperature change.,Analysing the geochemistry ...
Breaking Biology News(10 mins):Bullfrogs may help spread deadly amphibian fungus, but also die from it 2HIV prevention among female sex workers in India reduces HIV and syphilis 2Global cooling as significant as global warming 2
Other Tags
comparablemarimastatketektenthdarklyairwayeditsfluorideappropriationsconveysasmusualunprovengambiaopposeshivma