Tag: "travel" at biology news

Annals of Internal Medicine tip sheet for Oct. 5, 2004

...a cases occur. Most infections occur in people who travel abroad, and one of every 100 U.S. travelers with diagnosed malaria die. Researchers looked at records of U.S. travelers in a national registry who died of malaria between 1963 and 2001 (Review, p. 547). Of 123 deaths, most (105 people, 85.4 perce...

Award-winning INEEL probe to help safely monitor hazardous waste sites

...still. Sometimes, molecules of hazardous waste can travel out of landfills, wandering through soil layers near aquifers. Technology exists to monitor landfill perimeters, but scientists would prefer to keep an eye on contaminants long before they leave the area. Now with a new underground probing system fro...

Time-lapse movies show brain cells move like a two-stroke engine

...n embryo into an infant or young animal. They then travel outward to form the brain's outer layer, or cortex...aled this motion in 1987. With each step the cells travel a little more than a micron, or about half the width of a hair over the course of an hour. The new s...

Globetrotting pollutants turn up on Toronto street

..."flight tube". Lighter molecules take less time to travel down the flight tube, giving the researchers the particle's chemical signature. Evans says that once they build up a library of particles, this research could make it possible to identify pollutants without any knowledge of their origin. ...

Yale professor named 2004 Biomedical Engineering Society Distinguished Lecturer

...g and consists of a plaque, a $1000 honorarium and travel expenses. An important function of the lecture was to critically review a field of biomedical engineering and offer a vision of its future. Saltzman received his B.S. with distinction from Iowa State University and his M.S. and Ph.D in Chemical Engin...

Soaking up signal: Endocytosis controls spreading and effective signaling range of Fgf8 protein

...s such as Fgf8 are emitted by particular cells and travel within tissues in the extracellular space, where they signal to the "target" cells they encounter. Spatial control of this signaling is crucial during development, but the mechanisms by which the spreading of Fgf8 protein is controlled in a field of ...

Sandbagging cancer in the bloodstream

...y leaky." Once in the circulation, tumor cells can travel to distant parts of the body. Often tumor cells that are in the bloodstream get lodged in small blood vessels. Up until now it has not been clear how the tumor cells actually get out of these vessels and form new tumors in distant organs, says Cheres...

Gene therapy approach reverses diabetic neuropathy in animal model, Pitt study finds

...o sensory neurons. Once delivered, the HSV vectors travel up the nerve to the sensory neuron cell body located within a cluster of other neuron cell bodies called the dorsal root ganglia. Inside the neuron cell body, the encoded genes are used to make natural NGF or NT-3 proteins, thereby protecting the neu...

Scientists closing in on nerve proteins' contributions to memory and hearing loss

...e ears let Nrg-ICD break away from the synapse and travel to the nucleus of the nerve cell, where it blocked genes related to a cellular self-destruct process. In the new study, researchers showed that in addition to increasing levels of Ngr-ICD, stimulation of the nerve cells caused a corresponding i...

Actin muscles in on DNA transcription

...egments into messages made of RNA." These messages travel out to the cytoplasm, where they serve as templates for building proteins, including actin itself. "If actin is blocked, transcription can't begin," de Lanerolle said. The finding is published in the current issue of Nature Cell Biology and follows a...

Researchers discover transport molecule that allows boron into cells

...nsporting proteins that allow charged molecules to travel across cell membranes. Ion transporters are embedded in the cell membrane, opening and closing like gates to let charged ions and molecules enter and leave the cell. The movement of these molecules affects numerous essential cellular functions. L...

Computer models to simulate hypothetical outbreak of avian flu

...on of schools, locations of hospitals and clinics, travel and the infectiousness of the virus. These simula...c groups, using antiviral medications, restricting travel or implementing other public health measures," said Irene Eckstrand, Ph.D., MIDAS program officer at...

How running made us human

... years ago while they also retained the ability to travel through the trees. Yet Homo with its "radically transformed body" did not evolve for another 3 million or more years Homo habilis, Homo erectus and, finally, our species, Homo sapiens so the ability to walk cannot explain anatomy of the modern huma...

Scientists develop 'electronic eye' for the blind

...ns have, for example, been made to the most common travel aid used by blind people, the white cane. There are some canes with added functions which use lasers or ultrasound to detect more distant obstacles. One such is the Talking Cane from Sten Lfving Optical Sensors in Sweden. But this technology can't gi...

University of South Florida designated Center of Excellence by Huntington's Disease Society

...s living throughout Florida will no longer have to travel to Atlanta, Georgia, or Birmingham, Alabama, to receive the exceptional quality of care offered by an HDSA Center of Excellence. We look forward to working with the staff at USF to make this an outstanding Center of Excellence, which we will formally...

Science and medicine - bridging the gap

...d, including stipend support and health insurance, travel to medical meetings, expenses of clinical training experiences, and tuition. "HHMI already supports two programs that give medical students insight into the world of basic science research: Research Fellowships for Medical Students and the HHMI-NIH ...

Study: Eat leafy green veggies to help prevent cataracts

... reach the eye in the first place," he said. "They travel through the bloodstream, but the lens doesn't have a blood supply." This work was supported in part by the Ohio Agricultural Research and Development Center and the Virginia Vivian Scholarship Fund of Ohio State's College of Human Ecology...

Stanford biologist working to restore native forests to Hawaii

...har is leading the ecological efforts and plans to travel to Hawaii in January. While there, she will survey native plant and animal diversity on several sites with various degrees of tree cover, including pasture, restored forest and mature forest. Doctoral student Joshua Goldstein is conducting the financ...

What have scientists learned since Mount St. Helens erupted?

... research ecologist. One of his first assignments: travel to Mount St. Helens 2 months after the historic eruption and study the aftermath. Crisafulli and his colleagues traveled by helicopter into the volcanic disturbance zones to gather ecological data. Crisafulli, a scientist at the USDA Forest Service...

Four Max Planck Partner Groups starting in India

...ix highly-qualified junior scientists will receive travel funds totaling 3,000 euros per year and will reside for one month of each year at a Max Planck Institute. By 2008, the number of fellowship holders should balance out to approximately 60 per year. The basis for the new cooperation is an agreement tha...

1 2 3 4 5 6 7 8 9 10

(Date:4/17/2014)... recent Yokahama IPCC meeting painted a stark warning on ... which has a greenhouse effect 32 times that of ... shown that humic substances act as fully regenerable electron ... are held in wetlands instead of being released to ... system is disrupted it may enter into a vicious ...
(Date:4/17/2014)... the genetic information of DNA is used to ... numerous different functions in living organisms. Messenger RNA ... expression, by relating the genetic information of DNA ... , By examining the different types and ... at a given time, researchers can determine which ...
(Date:4/17/2014)... way the immune system may fight cancers and viral ... cells to treat illness. , The research, in mice, ... "neighborhood police" specialized squads of defenders that patrol ... entire city, the body. , Scientists at Washington University ... the liver, skin and uterus each has dedicated immune ...
Breaking Biology News(10 mins):Methane climate change risk suggested by proof of redox cycling of humic substances 2Rapid and accurate mRNA detection in plant tissues 2Some immune cells defend only 1 organ 2
Other Tags
pandoraswettergrasslandsleftieshygieniccapacitiesmusculaturemirnasawaresummitkyotoesabrachytherapyinversetemporarilysue