Tag: "tungsten" at biology news

Component of volcanic gas may have played a significant role in the origins of life on Earth

...H3 gases in a glass apparatus containing a pair of tungsten electrodes. He subjected the chemicals to an electric discharge, intended to simulate conditions on the early Earth, and he collected and analyzed the molecules that formed--which included the amino acids alanine, glycine, and a few others. In the ye...

Diamonds are a doctor's best friend

...or drill bits and abrasive materials, non-clogging tungsten carbide milling inserts for engineering applications, and more efficient, lower friction, automotive components that are more fuel efficient. DLC coatings are also biocompatible and unlike other types of coating don't trigger the coagulation of blood...

On the cutting edge: Carbon nanotube cutlery

...n nanotube between two electrochemically sharpened tungsten needles. In the resulting prototype, the nanotube stretches between two ends of a tungsten wire loop. The knife resembles a steel wire that cuts a block of cheese. To begin demonstrating the...

Scientists learning to create nanomaterials based on micro-algae patterns

...nique called microparticle bombardment. DNA-coated tungsten particles are shot on the diatoms under high heliumpressure, thus enabling them to penetrate the strong diatom cell wall. The diatom incorporates the introduced DNA into its genome, and selection of the transfected cells is achieved using the antibio...

Tree rings show elevated tungsten coincides with Nevada leukemia cluster

...ccording to a new research report. The amount of tungsten in tree rings from Fallon quadrupled between 1990 ...logy. "Tree ring values for the early 1990s for tungsten are roughly equivalent to nearby towns, but go up in Fallon in the mid-1990s while staying the same ...

1

(Date:8/28/2014)... N.C. -- Scientists have identified the developmental on-off switch ... that produce more than two-thirds of the world,s naturally ... be to see whether it is possible to manipulate ... , The study, appearing August 28 in ... small molecule called cyclic-di-GMP and a larger protein called ...
(Date:8/28/2014)... examples of complex systems. Their infrastructure equipment requires ... cooling, transport to supply fuel, and ICT systems ... network chain is interconnected with a wider network ... of UK-based scientists has studied various aspects of ... been published in EPJ B by Gaihua Fu ...
(Date:8/28/2014)... Cars, planes and ... sophisticated assembly lines. Mobile assembly carriers, on to which the ... lines. In the case of a car body, the assembly ... precise spatial and chronological sequence, resulting in a complete vehicle ... such an assembly line at molecular level has been a ...
Breaking Biology News(10 mins):Small molecule acts as on-off switch for nature's antibiotic factory 2Small molecule acts as on-off switch for nature's antibiotic factory 3Inter-dependent networks stress test 2Nanoscale assembly line 2Nanoscale assembly line 3
Other Tags
speedycootsovulationperimenopausalpeeksgenesystemsstrepasidewallsbumpdegradationimmunitiesbrandedpolymerpurduesexes