Tag: "blocker" at medical news

Women less likely to get quality heart attack care

...ies to increase hospitals' use of aspirin and beta blocker drugs, and cholesterol testing, within 24 hours of a heart attack, and the prescribing of aspirin, beta blockers, cholesterol-lowering drugs and ACE inhibitor drugs for patients leaving the hospital. It also seeks to increase the number of patients w...

Investigational transplant drug effectively preserves kidneys while avoiding toxic side effects

...critical because, while we knew the co-stimulatory blocker was effective in vitro, we needed to study it in a living organism," said Dr. Larsen. "The nonhuman primate studies allowed us to take a bold step toward studying this medication in humans to determine if it is a better choice than the current standa...

Penn researchers add more evidence to demonstrate role of COX inhibitors in heart-disease risk

..." says FitzGerald. "Its effects or those of a TxA2 blocker on hardening of the arteries has never been studie...group figured that they might need to add the TxA2 blocker to see the anti-inflammatory benefit of the COX-2 inhibitor. Adding the COX-2 inhibitor not only fa...

Certain high blood pressure combination therapies elevate risk for death from cardiovascular disease

...er ACE inhibitor, beta-blocker, or calcium channel blocker or ACE inhibitor plus calcium channel blocker. The researchers found that among 2-drugclass combinations, diuretics plus calcium channel blockers were associated with approximately doubling of the risk of CVD death compared with diuretics plus beta-...

Success of new treatment halts international blood pressure drug trial

...ar benefits in favour of the newer calcium channel blocker plus angiotensin converting enzyme inhibitor treatment when compared with the beta-blocker, atenolol and the thiazide diuretic, bendroflumethiazide. This announcement signals the end of the main clinical elements of the ASCOT trial, launched in 19...

Taking pills, even if placebo, predicts better survival in heart failure

...s for both the placebo and an angiotensin receptor blocker (ARB), a medication used to relax and dilate blood vessels, when compared to patients who were not as adherent. Also, good adherence was associated with lower rates of hospitalization for both placebo and active drug. "Adherence to medications is one...

Calcium channel blocker reduces adverse cardiovascular events in certain patients

The calcium channel blocker amlodipine decreases the risk of cardiovascular ev...02). Patients received either the calcium channel blocker amlodipine (10 mg); the angiotensin-converting enzyme (ACE) inhibitor enalapril (20 mg); or placebo....

Heart surgery patients receive less aggressive discharge care

...ot receiving aspirin," Dyke said. The rate of beta blocker usage was 88 percent for angioplasty patients, compared to 83 percent for bypass patients. Dyke said the surgical patients were much more likely to receive diet modification counseling (86 percent vs. 79 percent) and to be referred to c...

Detrol LA combined with standard treatment for enlarged prostate is twice as effective

...ing overactive bladder (OAB) symptoms as the alpha blocker alone in men with both bladder obstruction and OAB... OAB (n=68). All patients were treated with alpha blocker doxazosin for three months. In patients with no symptomatic improvement, DETROL LA was added for an...

New data demonstrates that Benicar(R) and Benicar HCT (TM) achieve JNC 7 blood pressure goals

...and hypertension; Benicar, an angiotensin receptor blocker indicated for the treatment of hypertension; Benicar HCT TM , an angiotensin receptor blocker and diuretic combination product indicated for the second-line treatment of hypertension; and Aerobi...

AstraZeneca submits regulatory application in Europe for use of Atacand(R) in heart failure

...Atacand is an angiotensin II type 1 (AT1) receptor blocker indicated for the treatment of high blood pressure...an losartan, the initially introduced AT1-receptor blocker 5,6,7,8. Recent clinical outcome studies with Atacand, SCOPE and CHARM, have demonstrated the clini...

Two better than one where lowering blood pressure is concerned

...tor (or an Angiotensin receptor blocker) or a Beta blocker in addition. For black patients they recommend using the same protocol as suggested for those over 55, regardless of patient's age, as the 'C and D' drugs are more effective on older people and in the black population than 'A and B' drugs. This is be...

Why don't heart patients take their medicine? Study finds forgetfulness at the top of the list

...ing up with their ACE inhibitors. Aspirin and beta blocker non-adherence rates were also in the 40 percent range. When asked why they didn't keep up with their medication schedule, the patients' top reason was that they had forgotten. Carelessness was second, followed by a few patients who said they didn't t...

Beta blockers usage low despite insurance

...e of the largest studies to date of long-term beta blocker adherence," said Donald Fetterolf, M.D. chair of C...they hope will provide additional insights in beta blocker use in the U.S., particularly how the usage differs by age and gender....

Implantable cardiac defibrillator use significantly lowers heart failure mortality

...t warfarin; and 14 percent angiotensin II receptor blocker (ARB). Participants were randomly entered into three study arms in equal proportions: conventional therapy plus a placebo; conventional therapy plus amiodarone; and conventional therapy plus ICD. The drug arms of the trial were double-blinded so that...

Beta blockers cost effective to society for heart failure treatment

DURHAM, N.C. -- Beta blocker therapy for the treatment of heart failure can pro...the Duke Clinical Research Institute (DCRI). Beta blocker therapy reduced societal costs by $3,959 per patient over five years, the study showed. However, whi...

Drop in hormone therapy use shows physicians heed clinical trial findings, Stanford researchers say

...alpha-blocker, an ACE inhibitor, a calcium-channel blocker and a diuretic. The alpha-blocker portion was halted early when researchers found that those taking the medication had a higher rate of heart failure. Although prescriptions for the alpha-blocker, known as doxazosin, decreased after the March 2000...

Combination therapy significantly delays progression of benign prostatic hyperplasia

...surprising finding of the study was that the alpha blocker doxazosin was not effective in reducing the long t...e have shown in this trial is that while the alpha blocker (doxazosin) clearly contributes to symptom relief and a reduction in symptom worsening, use of finas...

News tips for Tuesday, Nov. 11, 2003

...as taken a closer look at the angiotensin-receptor blocker losartan, shown to be superior to atenolol in lowering stroke risk in patients with high blood pressure and left ventricular hypertrophy (LVH). LIFE researchers now find that losartan therapy "is associated with consistent reductions in risk across ...

Newer formulation of heparin improves outcomes for suspected heart attack patients

... of the ACC/AHA guidelines." The platelet receptor blocker used to treat patients in this analysis, called glycoprotein (GP) IIb/IIIa inhibitors, occupies receptors on blood platelets, blocking them from forming clots. Kanwar Singh, M.D., cardiology fellow at the Duke Clinical Research Institute (DCRI), pres...

1 2 3

(Date:7/25/2014)... (PRWEB) July 25, 2014 AttorneyOne.com, a recognized ... latest information from the FDA on Ibuprofen and Oxcarbazepine ... that one lot of Ibuprofen and one lot of Oxcarbazepine ... due to mislabeled packaging. Oxcarbazepine is used for the treatment ... , The reason for the recall is that Lot ...
(Date:7/25/2014)... July 25, 2014 Parker Waichman LLP, ... of consumers comments on a recent tobacco lawsuit in ... smoker $23.6 billion in punitive damages. Cynthia Robinson brought ... cigarettes. The case is Cynthia Robinson v. R.J. Reynolds ... Florida First Circuit Court, Escambia County, Florida; Case Number ...
(Date:7/25/2014)... Drexel University College of Medicine is pleased ... been appointed vice dean for education, effective October 1, 2014. ... Medical College, where she is currently chair of the Department ... of medicine. , As a member of the senior ... major role in many aspects of the development of the ...
(Date:7/25/2014)... vulnerable neurons and reduce motor deficits in a ... University School of Medicine have shown. , The ... Parkinson,s Disease . , The findings demonstrate that ... at sufficient levels and have beneficial effects when ... Previous studies of XPro1595 in animals tested more ...
(Date:7/25/2014)... 25, 2014 The new report ... Feed, Pharmaceuticals and Others), by Type (Amylases, Cellulases, ... Geography - Global Trends & Forecasts to 2019", ... of the global Carbohydrase market with analysis of ... is segmented and values are forecasted on the ...
Breaking Medicine News(10 mins):Health News:Ibuprofen and Oxcarbazepine Tablets Recalled: AttorneyOne Monitors and Keep Consumers Informed 2Health News:A Florida Jury Awards Widow More Than $23 Billion in Punitive Damages in a Lawsuit Brought Against Tobacco Maker, R.J. Reynolds, Parker Waichman LLP Comments 2Health News:A Florida Jury Awards Widow More Than $23 Billion in Punitive Damages in a Lawsuit Brought Against Tobacco Maker, R.J. Reynolds, Parker Waichman LLP Comments 3Health News:Valerie D. Weber, MD, Appointed Vice Dean for Education at Drexel University College of Medicine 2Health News:Valerie D. Weber, MD, Appointed Vice Dean for Education at Drexel University College of Medicine 3Health News:Anti-inflammatory drug can prevent neuron loss in Parkinson's model 2Health News:Carbohydrase Market worth $3,717.7 Million by 2019 - Report by MarketsandMarkets 2Health News:Carbohydrase Market worth $3,717.7 Million by 2019 - Report by MarketsandMarkets 3Health News:Carbohydrase Market worth $3,717.7 Million by 2019 - Report by MarketsandMarkets 4
Other Tags
historyevolutionarysalamanderrewritesbrewsphysicistsmillipedescavechemoembolisationpfilegatomariannepersonalizedheaviertvsenlargement