Tag: "changing" at medical news

Some brain cells 'change channels' to fine-tune the message

... So far, no one has really looked for the channel changing in other cells in the brain, he says, in part beca...ed stellate cells). But Huganir thinks the channel changing is going to be relatively common in the brain. Whether through channel changing or other, more well-...

College alcohol problems exceed previous estimates

...among college students, and whether this figure is changing over time." The researchers conclude that greater enforcement of the legal drinking age of 21 and zero tolerance laws, increases in alcohol taxes, and wider implementation of screening and counseling programs, and comprehensive community intervention...

Mechanism of RNA recoding: New twists in brain protein production

...otein assembly. Often, even simple editing such as changing one letter in an RNA molecule affects the resultin...cally "retypes" RNA letters at specific locations, changing adenosine (A) to inosine (I). Proteins responsible for fast chemical and electrical signaling in ani...

New ways to design safer & more effective topical (transdermal) drug delivery announced in the PNAS

...PEs help drug molecules penetrate into the skin by changing the structure of the SC. Different CPEs penetrate the skin in unique ways. For example, some make microscopic holes in the SC by removing lipids. Others insert themselves in already-crowded lipid bi-layers to disorganize them. Some can also break ope...

HIV-1 spread through six transmission lines in the UK

...esistance. Scientists used this data to follow the changing number of infected individuals through time and estimate the demographic parameters shaping the epidemic. During the exponential growth phase, the transmission chains had an average growth rate of a doubling of the number of people infected each yea...

Common anesthetics appear safe for developing fetal brain

...robe against the skull of the fetus to measure the changing oxygenation levels of blood circulating in the brain, Reynolds said. Reynolds said that the increase in oxygenation in the fetal brain is likely due to isoflurane, one of the three commonly used agents, which induced reductions in oxygen metabolism a...

Is your job giving you a heart attack? Occupational health conference answers that, and more

...rch is being presented in the following areas: the changing nature of work; the relationship between working conditions, social class and social inequality as determinants of cardiovascular disease research; and the relationship between working conditions, social class and social inequality as determinants of...

Men more likely to get screened for prostate cancer than colon cancer, U-M study finds

...ore effective than untimed formal interventions at changing health behavior. The researchers also suggest targeting information on colon cancer to the type of patient less likely to be screened for the disease. The study found men who were not compliant were younger, were Hispanic, had lower education and inc...

Society of Hospital Medicine to launch new medical journal

...re," said Dr. Wellikson. "Hospitalists are rapidly changing the way physicians care for hospitalized patients by encouraging working together in teams within the hospital setting," Dr. Wellikson continued. "That makes it imperative for our Society to take a larger education and leadership role by publishing ...

More training needed to care for growing geriatric population

CINCINNATI--The changing medical needs of the growing 65-and-over populatio...D, of UC's Institute for the Study of Health. "The changing needs of the geriatric population have shifted that trend. Now, more than 50 percent of all outpatie...

NASA awards $9.8 million NSCOR grant to UT Southwestern to study effects of space radiation exposure

...chanisms that enable living organisms to adjust to changing demands imposed by the environment....

OHSU scientists develop MRI approach to improve breast cancer detection

...s can change during the examination, much like the changing of a camera's shutter speed. On a camera, a fast s...e. "His 'shutter-speed' model has the potential of changing our approach to cancer screening in general and may also play a role in determining the early effect...

Impact of scientific advances on drug studies and membrane research to be explored

... presentations and discussions centered around the changing role of medicine in society, the future of drug di...teins to cross membranes and receptors that signal changing conditions of a cell's environment, to the molecular biology and genetics of the membrane processes ...

Hormone therapy controversy raises drug safety issues

...been resistance among many physicians and women to changing beliefs and practice patterns?" the researchers ask. They conclude that the conflicting interests of women, physicians and drug companies played a role in the popularity of HT (at one time it was one of the most commonly prescribed drugs in the Unite...

Using the internet's power and anonymity to reduce problem drinking

...everal options for how they would like to go about changing their drinking. Interventions that have these elements are more likely to reduce drinking. Effective computer interventions basically pull from these common elements. In fact, many drinkers seem to prefer this format. It's a way to save face, and...

Promising treatments for Huntington's disease identified in UCI study

...ed Huntingtin protein (Htt) linked to the disease, changing its chemical properties and making it more toxic. In addition, they found that drugs called HDAC inhibitors, which were developed for cancer chemotherapy, were able to prevent neuron damage in fruit flies carrying mutated Htt proteins. Marsh is profe...

Penn joins major NCI research initiative to advance breast cancer therapies

...therapy is so complex a challenge that it requires changing the paradigm in which biomedical research is performed," explains Chodosh. "Traditionally, biomedical research is performed by small groups of departmentally based specialists working in relative isolation. In contrast, the MMHCC is based on the prem...

Study casts doubt on increased mobility among US population

...reasingly mobile society" - that the population is changing residence at increasing levels. However, a new study provides empirical evidence in favor of an opposite trend. In fact, overall mobility has generally declined since about 1950, and interstate mobility has generally not increased during the same per...

States find alternate routes to health coverage

...ke existing programs work most effectively in this changing environment," says Burton. Most states endured another bad budget year without making deep cuts to their Medicaid programs. This reflects Medicaid's essential role as a source of health coverage for vulnerable populations. However, a combination ...

Older people get the big picture faster, and they are less inhibited

...story, and they provide clear insight into what is changing in the ageing brain." Using computer-generated stimuli, the researchers monitored how much time subjects needed to process information about the direction in which a set of bars moved. When the bars were small, or when the bars were low in contrast (...

1 2 3 4 5 6 7 8 9 10

(Date:11/24/2014)... (PRWEB) November 24, 2014 Global ... 6.19 billion by 2020, according to a new ... rates of cardiac arrhythmias clubbed with growing global ... this market. Though still in the budding stage, ... rise in usage rates in the recent times, ...
(Date:11/24/2014)... 2014 Residents of retirement communities in ... year’s SENIORS GOT TALENT, an annual online talent competition ... players to classic crooners, to seniors partying on a ... are indeed living young. , “SENIORS GOT TALENT, while ... cash prize, has always been about highlighting the vibrancy ...
(Date:11/24/2014)... York (PRWEB) November 24, 2014 The ... by the Family and Children's Association to ... as soap, shampoo, mouthwash and other such items.The Association's ... who are home bound, living in nursing homes, assisted ... to greatly enhance the well being of seniors throughout ...
(Date:11/24/2014)... SafeHandles™ announced that they will be featured ... Jr, airing via Discovery Channel. Dates and show times ... non-invasive, replaceable, and affordable germ protective device. This segment ... and adhesives to promote hand hygiene in high traffic ... SafeHandles is the desire to make a positive impact ...
(Date:11/24/2014)... Pittsburgh, PA (PRWEB) November 24, 2014 ... as he was trying to cross the street in ... "The driver never saw him. I came up with ... easily visible at night." , He developed the Safety ... night or in low-lighting conditions. The device ensures that ...
Breaking Medicine News(10 mins):Health News:Electrophysiology Devices Market Worth Forecasted To Reach $6.19 Billion By 2020: Grand View Research, Inc. 2Health News:Electrophysiology Devices Market Worth Forecasted To Reach $6.19 Billion By 2020: Grand View Research, Inc. 3Health News:Electrophysiology Devices Market Worth Forecasted To Reach $6.19 Billion By 2020: Grand View Research, Inc. 4Health News:Nursing Homes & Assisted Living Retirement Communities Enter Seniors Guide's Seniors Got Talent 2Health News:Nursing Homes & Assisted Living Retirement Communities Enter Seniors Guide's Seniors Got Talent 3Health News:The Holiday Inn Westbury - Long Island gives back to the local Long Island community, and also goes beyond borders to assist those in need during the 2014 Holiday Season 2Health News:The Holiday Inn Westbury - Long Island gives back to the local Long Island community, and also goes beyond borders to assist those in need during the 2014 Holiday Season 3Health News:New Episode of Innovations TV Series to Feature SafeHandles™ 2
Other Tags
interactivemucolipidosisregularlyace2elbowtenniscushingpituitaryusgsagigrapefruitreleasewishespacemakerafghanistanreturning