Tag: "february" at medical news

American Thoracic Society Journal news tips for February (second issue)

COMPUTED TOMOGRAPHY DETECTS LUNG CANCER AT EARLIEST STAGE... ...In a study that screened 1,520 individuals age 50 and over at high risk for lung cancer, low-dose...computed tomography detected 23 cases alone while sputum cytology analysis detected two alone, according to Mayo Clinic investigators. (Lung cancer is the most common fatal malignancy among adults in the U.S.) Researchers pointed to...

'EuroVacc 02' HIV vaccine trial begins in February 2005

Lausanne, Switzerland and London, United Kingdom, February 16, 2005 -- The European Vaccine Effort against HIV/AIDS, today announced that a phase I clinical trial of novel investigational vaccines comprising DNA-HIV-C and NYVAC-HIV-C for the prevention of HIV infection has started in Lausanne and London in February 2005. These vaccines are based on HIV subtype C, which is prevalent in China, Ind...

American Thoracic Society Journal news tips for February 2005 (second issue)

...... ...... ......Please contact Suzy Martin by phone at (212) 315-8631 or via e-mail at with questions.... MONTELUKAST SIGNIFICANTLY REDUCES ASTHMA EXACERBATIONS...IN YOUNG CHILDR...

News briefs from the journal CHEST, February 2005

...... Childhood asthma and current wheeze may be associated with different risk factors than bronchial hyperresponsivenes (BHR), according to a new study. Researchers at the David Hide Asthma & Allergy Research Centre, St. Mary's Hospital, Newport, Isle of Wight, UK, compared multiple environmental and genetic factors affecting children at 1, 2, 4, and 10 years of age and whether the children...

American Thoracic Society Journal news tips for February 2005 (first issue)

...... In a study of 46 patients from six hospitals with severe community-acquired pneumonia, a 7-day course of low-dose hydrocortisone infusion hastened the resolution of the patients' pneumonia and prevented the development of life-threatening sepsis-related complications. The researchers infused hydrocortisone in 23 patients as an intravenous 200-mg bolus followed by infusion at a rate of 10...

Other highlights in the February 2 JNCI

...... Despite some improvement since 1988, the majority of patients with colorectal cancer in 2001 received inadequate lymph node evaluation to see if their cancer had spread, according to a new study....... Lymph node status is the strongest predictor of outcome for colorectal cancer patients. Only 40% of patients with lymph node metastases will survive for 5 years after diagnosis compared wit...

January/February Annals of Family Medicine tip sheet

...Contrary to common perception, injuries attributable to alcohol consumption are more likely to be associated with an occasion of alcohol consumption than with alcohol dependence. In this population-based study of 2,517 patients admitted to three emergency departments between 1998 and 2000, most alcohol-associated injuries occurred in persons who had consumed alcohol during the six hours befo...

Tip sheet for the February 24, 2004 Neurology

...One study led by Denise D. Correa, PhD, of Memorial Sloan-Kettering Cancer Center, found mild to moderate cognitive dysfunction in 28 survivors of PCNSL, a type of cancer where cells from the immune system grow out of control. The patients who were treated with methotrexate-based chemotherapy and whole brain radiotherapy had more impairment than those who had the chemotherapy alone.... ...I...

American Thoracic Society Journal news tips for February 2004 (second issue)

No asthma exacerbation help...from children's flu vaccination ... ...In a randomized, double-blind, placebo-controlled study in children with asthma, ages 6 to 18, Dutch researchers found that influenza vaccination did not significantly reduce the number, severity, or duration of asthma exacerbations caused by the flu. The investigators studied 349 children who received placebo vaccination...

Annals of Internal Medicine, tip sheet, February 17, 2004

......The U.S. Preventive Services Task Force has issued new recommendations for screening asymptomatic (apparently healthy) people for heart disease. The group does not recommend EKG, treadmill tests and CT scans to screen people at low risk for heart disease. It says that evidence is insufficient to recommend for or against using these three tests to screen for heart disease in asymptomatic ad...

Annals of Internal Medicine tip sheet February 3, 2004

... ...A study of 27,077 women found that those who took higher doses of aspirin seem to have lower risk for developing adenomas (a type of polyp that can become colorectal cancer) than those who reported never using or rarely using aspirin. The women had no known history of colon disease at the start of the study and had a colonoscopy or sigmoidoscopy between 1980 and 1998. Overall, 1,368 ca...

American Thoracic Society Journal news tips for February 2004 (first issue)

ANTIOXIDENT INCREASES ASSOCIATED WITH A...LOWER RISK OF ASTHMA PREVALENCE IN KIDS ......In a large cross-sectional study of survey data from U.S. youth under age 17, increases in the antioxidants serum beta-carotene and vitamin C, along with the trace mineral selenium which is also considered an antioxidant, were associated with a lower risk of asthma prevalence. Even stronger asthma reduction a...

February 2004 Ophthalmology Journal

SAN FRANCISCO--Studies from the February 2004 issue of Ophthalmology, the clinical journal of the American Academy of Ophthalmology, are now available. These include: ...... Biostatistical Education in Ophthalmology... Temporal Variation in Diabetic Macular Edema Measured by Optical Coherence Tomography... Intravitreal Triamcinolone Acetonide for Diabetic Diffuse Macular Edema: Preliminary Re...

Annals of Internal Medicine, tip sheet, February 19, 2002

Annals of Internal Medicine is published by the American College of Physicians-American Society of Internal Medicine (ACP-ASIM), an organization of more than 115,000 internal medicine physicians and medical students. The following highlights are not intended to substitute for articles as sources of information. For an embargoed fax of an article, call 1-800-523-1546, ext. 2656 or 215-351-2656. .....

Mayo Clinic Proceedings looks at epidemic of obesity in February issue

ROCHESTER, MINN. -Three articles and an editorial in the February Mayo Clinic Proceedings outline the difficulties facing people who are overweight, but offer some strategies that might help reduce the surge of obesity in the nations population.... ...In the United States, the prevalence of obesity increased from 12 percent in 1991 to nearly 18 percent in 1998.... ...A study of self-reported weig...

American Thoracic Society Journal news tips for February (first issue)

...... Higher perceived stress in caregivers (mostly mothers) of 2- to 3-month-old infants who had a genetic predisposition to asthma and allergy was associated with an increased risk of more wheezing during the first 14 months of life, according to researchers. Investigators recruited 496 children (263 males and 233 females) from a Boston hospital within 48 hours of delivery. Of the 496 child...
(Date:4/18/2014)... scientists could lead to potential new treatments for breaking ... , Fibrosis, or scarring, is a hallmark of ... lungs can lead to serious organ damage and, in ... options centers on findings made by Swati Bhattacharyya, PhD, ... that a specific protein plays in promoting fibrosis. ...
(Date:4/17/2014)... popular vaccine brands for children may not be the ... cost factors when choosing vaccines, driving the market toward ... a new study by University of Illinois researchers. , ... by numerous factors," says Sheldon H. Jacobson, a co-author ... and of mathematics at the U. of I. "In ...
(Date:4/17/2014)... NY In a review published in the April ... president of The Feinstein Institute for Medical Research, says ... medical community,s approach to treating sepsis, which ... Americans. , Sepsis occurs when molecules released into the ... throughout the body. Inflammation is necessary for maintaining good ...
(Date:4/17/2014)... many as 10 million older Americans suffer from depression, ... , However, new research a project that followed ... six years found that Internet use among the ... than 30 percent. , "That,s a very strong effect," ... telecommunication, information studies and media who led the project. ...
(Date:4/17/2014)... 17, 2014 EcoHealth Alliance, a nonprofit organization that ... a comprehensive review today examining the current state of ... review calls for improved global surveillance strategies to combat ... outbreak of Ebola in West Africa that has claimed ... Guinea and Liberia. According to the World Health ...
Breaking Medicine News(10 mins):Health News:New clues on tissue scarring in scleroderma 2Health News:Study recalculates costs of combination vaccines 2Health News:Feinstein Institute researcher publishes new perspective on sepsis 2Health News:Internet use can help ward off depression among elderly 2Health News:Re-emergence of Ebola focuses need for global surveillance strategies 2Health News:Re-emergence of Ebola focuses need for global surveillance strategies 3
Other Tags
pandoraswettergrasslandsleftieshygieniccapacitiesmusculaturemirnasawaresummitkyotoesabrachytherapyinversetemporarilysue