Tag: "influence" at medical news

Sexual lifestyles vary among ethnic groups in Britain

...nd demographic influences, other factors likely to influence risk of infection are how people choose sexual par...trongly suggests that gender roles and norms might influence the STI risk behaviour of men and women, and that they might exacerbate differences in sexual behavi...

OHSU scientists test medication to treat involuntary weight loss

...tain brain cells -- called the MC4 receptor -- can influence metabolism and appetite. Previous research involving mice demonstrated that when this specific cell receptor is blocked by delivering medications directly to the brain, the effects of cachexia are reversed. The animals' appetite and weight increase w...

Child care may affect entire community's risks of infection

...d Medical School researchers hypothesized that one influence might be the extent of child care use. Using data ...d that there are many factors that can potentially influence a community's level of pneumococcal carriage. "The model provides one hypothesis as to why some comm...

Oral bacteria may predict pregnancy outcomes

...erine environment through the blood stream and may influence the delivery process," explained Dr. Ananda P. Dasanayake, Department of Epidemiology and Health Promotion, New York University College of Dentistry. "Whereas the bacteria L.casei secretes acids that maintain the vaginal pH level below 4.5. This pH ...

Can you read my mind? W.M. Keck Foundation funds innovative brain research at Carnegie Mellon

...ity and how dysfunctions in specific brain regions influence the function of the entire brain system. In addition to this Keck Foundation grant, Mitchell and Just have received funding from the National Science Foundation for related studies, for a total of $1 million. "If successful, our research will resu...

Alcohol relapse adversely affects 10-year liver transplant survival

...lcohol relapse after liver transplantation and its influence on patient survival and transplant success, researchers had previously not studied patients for a longer follow-up period. Led by Antonio Cuadrado, M.D. of the Gastroenterology and Hepatology Unit of the University Hospital "Marqus de Valdecilla" in ...

Boston University team finds link between high cholesterol and better cognitive performance

... whether lowering cholesterol with medication will influence mental functioning. "The result of lowering cholesterol with current medications may be very different from naturally low cholesterol," said Merrill Elias. "We certainly need to evaluate what effect lowering cholesterol with medication will have. W...

Donor age has no affect on long-term liver transplant survival

... The authors conclude that while donor age did not influence the progression of recurrent hepatitis C, the absence of steroids and azathioprine did play a role and maintain that these associations need to be tested in a prospective randomized fashion....

College alcohol problems exceed previous estimates

...ndicate the number of students who drove under the influence of alcohol increased by 500,000, from 2.3 million ...while 2.8 million college students drove under the influence of alcohol in 2001, so too did 4.5 million college-aged persons who were not in college." Dr. Hingso...

Physicists find patterns within seemingly random events of physiological systems

...mics such as heartbeat, or indirectly, through its influence on motor activity control. Their analyses of heartbeat dynamics from participants show a significant circadian rhythm, including a notable response at the circadian phase corresponding to 10 a.m., the time of day most often linked to adverse cardiac...

Obtaining patient consent for clinical audit is unworkable without extra resources

... were asked for signed consent. Factors that might influence the chance of consent being given, such as age, illness severity, and length of hospital stay, were also assessed. Consent was obtained for 43% of admissions, only one refusal was received. Gaining consent for all admissions was difficult and varied ...

Genes for alcohol consumption identified

...know precisely why particular genetic variants may influence behaviour, but they do have a few clues. They foun...with alcohol consumption. The DRD2 gene appears to influence the 'high' that people derive from drugs such as alcohol. People without this variant might derive l...

US life expectancy about to decline, researchers say

...etic, psychological and environmental factors that influence diet or physical activity levels, says Dr. David Ludwig, associate professor and director of the Obesity Program at Children's Hospital Boston and a co-author of the study. For children in particular, fast food, sugar-sweetened beverages and other hi...

Teenage highs and lows

What risk factors influence teenagers to start experimenting with marijuana or to move from experimental to regular use? Involvement with other substances (alcohol and cigarettes), delinquency and school problems have been established as the three most important risk factors...

Most hospital executives have substantial concerns about mandatory error reporting systems

...amily. "In the hospital setting, executive leaders influence institutional policy and foster norms for their employees. These individuals believe that existing state reporting standards fail in some cases to provide clear guidance on what should be reported and that mandatory reporting systems with public disc...

Malt liquor beers, and the people who drink them, are different

...cern because alcohol advertising has been shown to influence brand choice, and brand choices during youth can influence beverage choices as adults." For this study, researchers conducted face-to-face interviews with 329 ...

Effects of education level on rates of obesity differ by race

...idence from previous studies suggests that SES may influence overweight and obesity for women of different racial groups. Ten T. Lewis, Ph.D., of Rush University Medical Center, Chicago, and colleagues examined the interactive effects of race and three levels of education: low, high school or less; moderate, s...

Neurobehavioral function during coma, stroke rehabilitation effective for elderly

...nal cord injury, pg 55 This study evaluates the influence of osteoporosis risk factors on bending of the tibia (shin) bone and discusses a method to identify at-risk groups for osteopenia following spinal cord injury (SCI). Investigators measured the tibia- bending stiffness in 175 able bodied men without k...

Study examines consequences of Thailand's 'war on drugs'

...ogy at the Bloomberg School of Public Health. "The influence of Thailand's 2003 'war on drugs' policy on self-reported drug use among injection drug users in Chiang Mai, Thailand" was written by Tassanai Vongchak, Surinda Kawichai, Susan Sherman, David D. Celentano, Thira Sirisanthana, Carl Latkin, Kanokporn W...

Simple question from your doctor can help identify your risk for breast cancer

...hich the early identification of risk status could influence screening practice behavior, had documentation concerning familial breast cancer." Little research has been done to examine how family cancer histories are obtained and utilized in clinical practice. Thus, the study focused on how women were asked a...

1 2 3 4 5 6 7 8 9 10

(Date:5/22/2013)... 22, 2013 Cedars-Sinai Heart Institute is honoring ... pioneer in modern mitral heart valve repair, Alain ... Corday, MD, International Prize in Heart Research. The ... recognize physicians and scientists conducting groundbreaking research, or ... medicine. , Carpentier is a leading ...
(Date:5/22/2013)... A new study provides neurobiological evidence for ... in people with insomnia, which may have implications ... , "Insomnia has been consistently identified as a ... Franzen, PhD, an assistant professor of psychiatry at ... in the brain circuitry underlying emotion regulation may ...
(Date:5/22/2013)... May 22, 2013 Digital Advertising Agency, ... behalf of its social media management client, Primal ... year's supply of the all-natural organic deodorant. The contest ... of the rapidly-growing start-up deodorant company based in Tampa, ... contest or sweepstakes on a Facebook page is a ...
(Date:5/22/2013)... (PRWEB) May 22, 2013 DiscountFurnaceFilter.com ... quality merchandise ranging from furnace filters, dehumidifiers, fans, ... is excited to add Stadler Form's product line ... summer product line (fans, aroma diffusers and dehumidifiers) ... Form’s Otto Fan is the perfect combination of ...
(Date:5/22/2013)... York, NY and Troy, NY (PRWEB) May 22, ... Medicine at Mount Sinai and Rensselaer Polytechnic Institute ... educational programs, research, and development of new diagnostic ... alliance was commemorated in a signing ceremony on ... initiative to use their expertise—Rensselaer’s in engineering and ...
Breaking Medicine News(10 mins):Health News:Heart valve repair innovator receives Cedars-Sinai Heart Institute's Corday Prize in Heart Research 2Health News:Study shows that insomnia may cause dysfunction in emotional brain circuitry 2Health News:Social Media Management Firm, 21Digital, Launches National Facebook Sweepstakes for Client, Primal Pit Paste 2Health News:DiscountFurnaceFilter.com Now Offers Stadler Form Products - Providing Solutions to All Your Summer Needs 2Health News:Icahn School of Medicine at Mount Sinai and Rensselaer Polytechnic Institute Announce Academic Collaboration 2Health News:Icahn School of Medicine at Mount Sinai and Rensselaer Polytechnic Institute Announce Academic Collaboration 3Health News:Icahn School of Medicine at Mount Sinai and Rensselaer Polytechnic Institute Announce Academic Collaboration 4Health News:Icahn School of Medicine at Mount Sinai and Rensselaer Polytechnic Institute Announce Academic Collaboration 5Health News:Icahn School of Medicine at Mount Sinai and Rensselaer Polytechnic Institute Announce Academic Collaboration 6Health News:Icahn School of Medicine at Mount Sinai and Rensselaer Polytechnic Institute Announce Academic Collaboration 7
Other Tags
deficitmammarymissilesguidedcoloradoinfluencesculturealoneopensdocumentedruinousmethamphtetamineflycheckfacedmetacognition