Tag: "map" at medical news

The trust game: Measuring social interaction

...eraction of that type completed a round. "What we map on are the changes in blood flow," said Montague. "Those tell us the amount of trust and trustworthiness, the degree of betrayal and benevolence." In early rounds, Montague and his colleagues were able to identify a physical response in the brain of ...

UCSF study offers insight into human circadian rhythms

...e (FASPS), the scientists created a family tree to map the incidence of inheritance, and made the seminal finding that the behavior was a single-gene trait. (Nature Medicine, Sept. 1999). In 2000, the team discovered the gene(hPer2) responsible for the condition in one particular family, the first report...

Giant iceberg B-15A edges past floating ice pier

...dicated ice-watching mission designed to precisely map changes in the thickness of polar ice sheets and floating sea ice. CryoSat, in connection with regular Envisat ASAR GMM mosaics and SAR interferometry a technique used to combine radar images to measure tiny millimetre-scale shifts between acquisit...

Brain imaging study may hold clues to onset of schizophrenia in people at high risk

...st pass" at determining feasibility of the tool to map tiny differences between patients and controls, Belger said. "We need to show that the tool is reliable and that, indeed, it's detecting something in the population that it's not detecting in healthy individuals," she added. "This is also a cross-se...

Promising new strategy for Swedish medical research

...itutet are planning an international initiative to map out the relationships between health, genes and lifestyle. Discussion partners include world-leading researchers from the USA, Britain, Singapore and Norway. The project has the working title "LifeGene". If realised, it could be classed as one of the...

CK2 protein sustains colon cancer cells by sabotaging ability to commit suicide

... to undergo apoptosis. In doing so, we've begun to map out a strategy for making cancer cells more likely to self-destruct." The findings of the current study support and expand those published by Houghton's laboratory last October in the journal Clinical Cancer Research. In that study, the team reported...

Researchers model brain's electrical storm during a seizure

... patient." Before surgery, neurologists needed to map the region where the patient's seizure originated to ensure that they only remove what is necessary. To help neurologists observe the patient's seizures, 64 electrodes were implanted into his brain for a week. The researchers were thus able to obtain...

Northwestern Memorial Hospital receives $10 million commitment to support preeminent heart program

...sive cardiac center and aims to put Chicago on the map as home to a world-class comprehensive heart program. "Neil Bluhm's generosity to our hospital will serve as a greater gift to people in Chicago and beyond who are looking for a premier center to provide state-of-the-art cardiac care," says Gary...

NYU psychology researchers show how attention enhances visual perception

...rain Imaging. This technology allows scientists to map activity in the visual cortex [see diagram of brain]. This experiment revealed that when a cue preceded the target, the target evoked a larger brain response than when the cue appeared in the other location. It also showed the magnitude of the cueing...

Views from space help oil prospectors see deep underground

... measure surface roughness, forming the basis of a map of coupling potential. Visible light images provide infrastructure and land use information that help determine accessibility for vehicles and people. Also, surface vegetation detected in this imagery may indicate sediment-buried water chan...

Genes in the interferon system important in SLE

.... Further functional analyses will be necessary to map the molecular mechanisms in detail. Besides the Rheumatology Clinic at Uppsala Akademiska Hospital, hospitals in Ume and Lund, in Sweden, and several hospitals in Finland as well as one hospital in Reykjavik provided the project with DNA samples and ...

AGI and USGS provide unique tsunami disaster relief

...in affected areas. The Global GIS, a large digital map database, provides datasets of historical seismicity, topography, geology, population density, roads, political boundaries, airfields and utility lines, among others. These datasets will benefit teams working in areas struck by the tsunami by supplyi...

Early learning leaves lasting changes in brain, Stanford owl study shows

...ion of an owl's brain. This area creates a spatial map out of the sounds an owl hears, such as the squeak...ome rustling in the leaves. The owl then uses that map to know precisely where to hunt for dinner. In his work, Knudsen and graduate student Brie Linkenhok...

Brain region identified that controls collecting behavior

...n, three-dimensional magnetic resonance imaging to map the lesions in each patient's brain and overlapped all the lesions onto a common reference brain. "A pretty clear finding jumped out at us: damage to a part of the frontal lobes of the cortex, particularly on the right side, was shared by the individ...

ESA service makes customised maps available to African aid workers

...the developing situation. But there is no detailed map of the Congo in the office library and it is too c...too long to order a special reproduction of a new map when the team has no idea of the seriousness of the crisis. The need is for something quick and simp...

University of Manchester uses crystals to help battle deadly diseases

...e University of Manchester, which uses crystals to map 'invisible' parts of molecules, is set to revolutionise drug discovery. The technique, which involves sending beams of neutrons through crystals at freezing temperatures, just a few degrees above 'absolute zero', will for the first time allow scienti...

Top 10 toys for children with ADHD

...mponents and is recognizable, such as an oversized map of the United States. Remove distractions. Does your playroom look like a toy store? Children with ADHD are easily distracted when there are lots of toys around vying for their attention. To help your child focus, it might be helpful to have a p...

Beyond supervision

...rd of. Using Williams' laboratory work as a road map to the intricacies of the inner eye, MacRae developed customized ablation, a custom version of refractive surgery that corrects for the previously unknown nuances of a person's vision. In the earliest days of refractive surgery, doctors didn't even k...

Alcoholics can have deficits in visuoperception and frontal executive function despite sobriety

...sks such as putting pieces of a puzzle together or map reading. A new study has found that, even with prolonged sobriety, alcoholics show deficits in visuoperception and frontal executive functioning of the brain. Furthermore, alcoholics utilize a more complex higher-order cognitive system, frontal exe...

Research on fabrics and cancer-fighting foods featured at ACS meeting

...nd DNA. Mass spectrometry is the technique used to map the human genome. (Thursday, Nov. 11, 5:15-6:30 p.m., Auditorium) Banquet honoring Ernest Eliel Professor Ernest Eliel of the University of North Carolina at Chapel Hill will be honored at a banquet Nov. 12. Professor Eliel is a world-recognized s...

1 2 3 4 5

(Date:8/21/2014)... (PRWEB) August 21, 2014 Recently, ... among their patients. Alternative medicine is on the ... to millenials. According to The Fiscal Times, young ... treatments over conventional medicine. , The Fiscal Times ... many millenials are embracing alternative medicine. The article ...
(Date:8/21/2014)... with advanced laryngeal cancer appear to have better ... nonsurgical chemoradiation. , Author: Uchechukwu C. Megwalu, M.D., ... Mount Sinai, New York, and colleagues. , Background: ... are diagnosed each year and squamous cell carcinoma ... Prior to 1991, total surgical removal of the ...
(Date:8/21/2014)... NC -- Researchers have pinpointed the environmental source of ... Southern California for decades. It literally grows on trees. ... of a 13-year-old girl, who spent the summer gathering ... hardest hit by infections of the fungus named ... Cryptococcus , which encompasses a number of species including ...
(Date:8/21/2014)... (HealthDay News) -- Not only is eating better and exercising ... of health-care dollars a year, a new study finds. ... health sciences at Wake Forest Baptist Medical Center in Winston-Salem, ... 2 diabetes patients. Participants ranged in age ... an intensive "lifestyle change program" focused on diet and exercise, ...
(Date:8/21/2014)... The W. Montague Cobb/ NMA ... national voice in the elimination of health disparities, ... the 112th National Medical Association’s (NMA) Annual Convention ... John Ruffin, Ph.D, former Director of the National ... life-long career and innovations have had a significant ...
Breaking Medicine News(10 mins):Health News:Van Uden Center Sees Growth in Alternative Medicine 2Health News:Surgery associated with better survival for patients with advanced laryngeal cancer 2Health News:Fungus deadly to AIDS patients found to grow on trees 2Health News:Getting Healthier a Big Money-Saver for People With Diabetes 2Health News:W. Montague Cobb/NMA Health Institute Honors Three Outstanding Leaders in Health Disparities 2
Other Tags
titantedstinkyhypertensivesdiesellaybeachremovesaceseekpreliminarymitralagesfactquotationsretarded