Tag: "slows" at medical news

Physical activity linked to protection from Parkinson's disease

...lso address the possibility that physical activity slows the progression of Parkinson's." The research was funded by the National Institutes of Health, National Institute for Neurological Diseases and Stroke and the Kinetics Foundation....

Routine use of nose-to-stomach tube slows recovery from abdominal surgery

...he return of normal intestinal functions, actually slows recovery, according to a new review of research. 1 The systematic review of evidence also shows that the practice may increase the risk of some postoperative complications. Cessation of bowel activity is one of the body's responses to the trauma of...

Nearsighted children may benefit from rigid contact lenses

...ldhood, around ages 8 to 14. Progression typically slows by the mid-teens for females and by the mid-20s for males. The researchers evaluated 116 children who participated in the Contact Lens and Myopia Progression (CLAMP) study at Ohio State. All children were given about two months to adapt to wearing th...

New study in NEJM suggests levodopa may slow progression of Parkinson's disease

..., however, "The results do not prove that levodopa slows the underlying nerve degeneration of Parkinson disease, and a differently designed clinical study will be necessary to address this concept." A follow-up study is already in the planning stages. Drs. Fahn and Shoulson further cautioned, "The high do...

Estrogen-associated COX-2 pathways explain protection from heart disease in female mice

...r menopause. Some studies have shown that estrogen slows heart disease in mouse models, but the mechanism i.... In mice treated this way, estrogen, as expected, slows hardening of the arteries. Taking away the receptor for PGI2 in those animals largely undermines thi...

Mayo Clinic discovers one mechanism for why men and women differ in immune response

...iving the difference: The presence of testosterone slows or weakens the response of T-lymphocytes. Delving further to discover the mechanism behind this response, the research team found that without testosterone, the T-lymphocytes "turn-on" more quickly. It also is possible that other sex hormones play ...

No justification for colposcopy in screening of young women for cervical cancer

...The finding that persistence of multiple HPV types slows rates of regression should be examined more closely." In an accompanying commentary (p 1642), Anne Szarewski and Peter Sasieni (Cancer Research UK) conclude: "Moscicki and colleagues have clearly shown just how common and essentially meaningless LSI...

Hebrew University one of 25 institutions involved in new European Vascular Genomics Network

...ll; the buildup of plaque narrows the arteries and slows the flow of blood); 3. Therapeutic angiogenesis that opens avenues for novel treatment of heart disease meant to improve cardiac oxygenation and reduce heart failure (angiogenesis is the science that studies the formation of new vessels which would ...

Solvent, common drug plus hormones raise risk of reproductive failures and breast cancers

...ss of enzymes (histone deacetylases) that normally slows the process of gene transcription, in which a portion of the genetic code is read, copied, and prepared for action within the cell. Without these enzymes there to inhibit gene transcription, the process loses its brakes and proceeds at an elevated pa...

Environmental enrichment lessens protein deficits in mouse model of Huntington's

...ronmental enrichment increases BDNF, and that this slows disease progression, provides a potential mechanism for the effects of environmental enrichment on Huntington's disease," says M. Flint Beal, chair of neurology at Cornell University Medical College in New York. The new study appears in the March 3 i...

Smoking linked to blindness

...e blind. Evidence also shows that quitting smoking slows the development of age related macular degeneration, whereas continued smoking can affect the long term response to treatments such as laser therapy. A sustained public health campaign in the UK is warranted to raise awareness of the link between smo...

Link between sleep, cancer progression explored by Stanford researcher

...prone to cancer-causing mutations. Melatonin also slows the ovaries' production of estrogen. For many ovarian and breast tumors, estrogen spurs the cancerous cells to continue dividing. Shift workers on duty through the night produce less melatonin and may therefore produce more cancer-activating estrogen...

Lucky number? Seven factors may increase clot buster use for stroke

...ases the risk of death or complications because it slows or prevents the clotting needed to seal a ruptured vessel. At hospitals that met all seven criteria, patients with ischemic strokes those caused by blood clots had a 4.7 times greater chance of getting tPA. "The seven criteria influence how rap...

The long view: Understanding why cancer strikes late

...cancers much more often, but the increase with age slows down later in life. In the new work, Frank asks how the passage through the benign early stages of cancer would cause the increase in cancer incidence to slow as one ages. His theory is that, early in life, we are well-protected because all of our ...

Bacterial DNA reduces inflammation in mice

...ivotal player in the chemical signaling chain that slows inflammation. In a series of experiments, the UCSD team showed that probiotic DNA exerts its effects through TLR9. Indeed, mice without the gene for TLR9 protein cannot benefit from probiotics, either living or irradiated, or from probiotic DNA. Tak...

Alzheimer's researchers begin unique study of tangles

...n a subset of 200 people to determine if valproate slows or alters the expected loss of whole brain volume in Alzheimer's. ...

Experimental drugs show promise in halting brain tumors

...ood supply is diminished and the tumor shrinks and slows its spread. Secondarily, ZD6474 prevented activation of the EGF (epidermal growth factor) receptor, another protein that cells use to grow new blood vessels, to resist dying, and to invade other cells. Blocking the activation of two growth factors ha...

Vital sign device improves resuscitation monitoring

...ormation, Welsh said. "If a patient's heart rate slows dangerously or his oxygen saturation level drops precipitously, the system will automatically adjust the transmission power so that a stronger signal is sent out and has a greater chance of being received by the paramedic," he said. "The radio would...

PTH and Alendronate: combining treatments shows no bone density advantage

...hyroid hormone (PTH) with alendronate, a drug that slows bone loss, produces no significant improvement in bone mineral density (BMD) beyond that produced by the individual drugs, according to two new studies involving postmenopausal women and men with low BMD. The two studies, reported in the September 25...

Caregivers refuse Alzheimers medications when patients quality of life threatened

...hy some caregivers decline to use a treatment that slows progression of the patient's disease, according to a new study from researchers at the Institute on Aging at the University of Pennsylvania School of Medicine. Their findings set for publication in the October 3rd edition of the Journal of the Amer...

1 2 3

(Date:7/25/2014)... (PRWEB) July 25, 2014 AttorneyOne.com, a recognized ... latest information from the FDA on Ibuprofen and Oxcarbazepine ... that one lot of Ibuprofen and one lot of Oxcarbazepine ... due to mislabeled packaging. Oxcarbazepine is used for the treatment ... , The reason for the recall is that Lot ...
(Date:7/25/2014)... July 25, 2014 Parker Waichman LLP, ... of consumers comments on a recent tobacco lawsuit in ... smoker $23.6 billion in punitive damages. Cynthia Robinson brought ... cigarettes. The case is Cynthia Robinson v. R.J. Reynolds ... Florida First Circuit Court, Escambia County, Florida; Case Number ...
(Date:7/25/2014)... Drexel University College of Medicine is pleased ... been appointed vice dean for education, effective October 1, 2014. ... Medical College, where she is currently chair of the Department ... of medicine. , As a member of the senior ... major role in many aspects of the development of the ...
(Date:7/25/2014)... vulnerable neurons and reduce motor deficits in a ... University School of Medicine have shown. , The ... Parkinson,s Disease . , The findings demonstrate that ... at sufficient levels and have beneficial effects when ... Previous studies of XPro1595 in animals tested more ...
(Date:7/25/2014)... 25, 2014 The new report ... Feed, Pharmaceuticals and Others), by Type (Amylases, Cellulases, ... Geography - Global Trends & Forecasts to 2019", ... of the global Carbohydrase market with analysis of ... is segmented and values are forecasted on the ...
Breaking Medicine News(10 mins):Health News:Ibuprofen and Oxcarbazepine Tablets Recalled: AttorneyOne Monitors and Keep Consumers Informed 2Health News:A Florida Jury Awards Widow More Than $23 Billion in Punitive Damages in a Lawsuit Brought Against Tobacco Maker, R.J. Reynolds, Parker Waichman LLP Comments 2Health News:A Florida Jury Awards Widow More Than $23 Billion in Punitive Damages in a Lawsuit Brought Against Tobacco Maker, R.J. Reynolds, Parker Waichman LLP Comments 3Health News:Valerie D. Weber, MD, Appointed Vice Dean for Education at Drexel University College of Medicine 2Health News:Valerie D. Weber, MD, Appointed Vice Dean for Education at Drexel University College of Medicine 3Health News:Anti-inflammatory drug can prevent neuron loss in Parkinson's model 2Health News:Carbohydrase Market worth $3,717.7 Million by 2019 - Report by MarketsandMarkets 2Health News:Carbohydrase Market worth $3,717.7 Million by 2019 - Report by MarketsandMarkets 3Health News:Carbohydrase Market worth $3,717.7 Million by 2019 - Report by MarketsandMarkets 4
Other Tags
historyevolutionarysalamanderrewritesbrewsphysicistsmillipedescavechemoembolisationpfilegatomariannepersonalizedheaviertvsenlargement