Tag: "wake" at medical news

Women Say Overwhelming Yes To Ultrasound In New Study

... the survey results are interesting, coming in the wake of 1993 study of 15,000 women, published in the New England Journal of Medicine, that showed no medical benefit from routine ultrasounds. Recent studies in Europe, however, have shown that mothers who received an ultrasound bonded better with their ...

New Short-Acting Anesthetics Cut Recovery Time

... of more rapid awakenings, which allows childrento wake up to the comfort of their parents nearby, rather than feel surroundedby medical personnel in the recovery room. "Kids coming out of surgery wouldrather see Mom than some stranger like me in a white coat," said Apfelbaum. Older people are particularl...

Cedars-Sinai Surgeons Present TeleSurgery

...pital," said Dr. Fontana. "In contrast, these kids wake up essentially painfree. We don't divide any muscle. Instead, we simply split the fiber with theselittle tools." Robert J. McKenna, specialist in thoracic surgery at Cedars-Sinai, willdemonstrate a video-assisted thoracic surgery (VATS) lobectomy, s...

Unlocking Secrets Of The Body's Inner Clock; Researchers Discover Key Control Mechanism For An Area Of The Brain That Regulates Sleep

...tently exposed to light before they would normally wake up, theircircadian clock did not shift, suggesting...ts light into a brain signal telling the animal to wake up. "The most important signal you get to your biological clock is light,"said Allen. "Ther...

UI Researcher Shows Economic Benefits Of Hospitals Fast-Tracking Patients Vary

...ts because less staffing time is required.Patients wake up more quickly and can leave the operating room sooner. Inaddition, the patients might not have to stay in the recovery room as long. If ahospital pays its ambulatory surgery center staff an hourly rate and thefast-tracking reduces substantial overt...

Knife-Less Brain 'Surgery' Offers New Treatment Options

...ssel without major surgery. "Now, I don't have to wake up every morning wondering if this is going to be the day," said the 45-year-old Swestyn. A small incision was made in Swestyn's leg so a flexible tube called a catheter could be threaded through his blood vessels into his brain. Through this tu...

Women May React To General Anesthesia Differently Than Men

...ing that has perplexed researchers, women appearto wake up almost twice as fast as men when general anesth...re that best determines how quickly a patient will wake up after anestheticswere withdrawn. Faster recovery would not only benefit a patient, but would save...

Component of aspirin prevents antibiotic-induced deafness

... threat of antibiotic-resistanttuberculosis in the wake of AIDS, however, makes it likely that their use willincrease in the future," Schacht added. After years of research, Schacht and his colleagues reported in 1995 thatgentamicin combines with iron in the body to trigger production of freeradicals---un...

A new strain of flu has turned up in Hong Kong

...as no evidence of human-to-human spread.But in the wake of that scare, Peter Patriarca, a senior official with the USFood and Drug Administration who was responsible for drawing up an emergencyaction plan for the US in the event of a pandemic, warned that too few resourceswere being devoted to the project...

LSU hurricane experts

...d nowhere else to turn and how people react in the wake of a storm that has destroyed their property, their communities, etc. Their Web sites are http:// lapop.lsu.edu/beggs.html and http://www.lapop.lsu.edu/hurpub.html . -- Scott Feld, professor, 225-388-1786, sfeld@lsu.edu . Feld can discuss h...

Hurricane tip sheet

...e looked at hurricanes and how people react in the wake of a storm that has destroyed their property and their communities. They study why people do or do not evacuate and who the victims relied upon when they had nowhere else to turn. Husband and wife team: -- John Beggs, associate professor, LSU Dep...

New rapid anthrax test developed through collaboration between Mayo Clinic and Roche Diagnostics. Test, which provides results in less than one hour, will be made available to United States laboratories

...rtise to state and federal health officials in the wake of the reported cases of anthrax exposure. Roche is working with the FDA to determine requirements for expedited regulatory approval. Initially, tests will be offered to laboratories at no charge. "People who suspect they have been exposed to anthrax...

Foot-and-mouth 'on the move in Asia'

...ase of FMD has been high, but we recognised in the wake of the UK outbreak that we could do more to prepare for a long running outbreak of the disease, he says. The training program and reagent purchase were made possible by the injection to AAHL of an additional $500,000 from the Federal Government. Dr G...

Tackling the threat of nuclear terrorism

...and additional cases of radiation sickness. In the wake of such an attack, the ability to aid survivors would be very limited. The international community urgently needs to expand its effort to secure existing stockpiles of nuclear weapons and materials, particularly in Russia, Pakistan, and India. The ef...

Habitually sleeping more than 8 hours, need for daytime nap signal increased risk of death from stroke

...hing briefly and repeatedly during the night. They wake frequently gasping for breath, which robs them of restful sleep and can lead to drowsiness during the day. The condition is recognized as a contributor to heart disease and stroke. Earlier research conducted by Qureshi with 1,348 adults who partici...

Link found between kids sleep, behavior problems

...t, to breathe through the mouth during the day, to wake up feeling unrefreshed, or to have a hard time waking up. All these can mean a child has sleep-disordered breathing, which can affect the quality of their sleep. Scores for snoring frequency and severity, and for sleepiness and sleep-disordered brea...

First European trial for new breast cancer vaccine

...ein, including the inserted tetanus fragments that wake up the immune system and help it to respond to HER-2. Dr Leach said the company was also preparing to start clinical trials in a variation of this approach. Instead of a DNA vaccine that prompts the bodys cells to make the necessary protein, the Auto...

Let them sleep!

...o improve attendance in this age group. The later wake times of the older teenagers in the current study further suggests that there may be benefits to starting school later. However, this is a complex issue that needs to be studied further, Reid said. It is likely that further analysis of sleep data ...

Tired and angry? Both emotions may predict heart attacks

... a feeling of hopelessness recently?; Do you ever wake up with a feeling of exhaustion and fatigue?; and, Do you have a feeling that you cant cope?TA and VE were ranked in groups of high, medium and low. The study found that persons who scored in high TA or high VE levels had a 42 percent greater long-t...

Yale researchers report on brain activity believed related to sudden infant death syndrome

...rbon dioxide levels during sleep may alert them to wake and breathe deeply. "When someone falls asleep wit... rise," Richerson said. "The normal response is to wake up slightly, turn the head, and breathe harder. There is evidence that some infants that die of SIDS...

1 2 3 4

(Date:8/29/2014)... August 29, 2014 According to these recent ... of Herpes and HPV cases in the last few years. ... the nature of these infections and the symptoms that make ... an STD. While some people aren't aware of the exact ... infections.” , The steady increase in the number of cases ...
(Date:8/29/2014)... August 29, 2014 How can ... proposition and provide top notch services. Dr. Michael ... practice by partnering with a double board certified ... launching two new websites! , Dr. Fiorillo’s services ... face surgical procedures. Some of these are breast ...
(Date:8/29/2014)... Today, Fecbek, a well-known female boots manufacturer and retailer, has ... The new items are offered in many styles, including sexy ... these products are nice-looking and elegant with the latest styles. ... , A boot is a type of footwear and a ... and the ankle and extend up the leg, sometimes as ...
(Date:8/29/2014)... Today, Progene reaches another milestone as the only testosterone ... healthcare network , but also with enrolled providers nationwide who ... few weeks ago. Today, we’re now recommended by healthcare ... , The network adds an unprecedented level of service to ... and after they make a purchase -- with the best ...
(Date:8/29/2014)... York, ON (PRWEB) August 29, 2014 Most ... professional needs to find a break in their day to ... always easy for business professionals to find a few hours ... announcement by North York Dental so important. It is now ... care that they need. , What is happening? , North ...
Breaking Medicine News(10 mins):Health News:It was reported that the Number on PositiveSingles.dating increased about 20% in 2014 2Health News:Michael Fiorillo’s Advanced Plastic Surgery Center Expansion – New Vein Specialist and Websites Launch 2Health News:Michael Fiorillo’s Advanced Plastic Surgery Center Expansion – New Vein Specialist and Websites Launch 3Health News:Nice Boots for Sale at Fecbek.com 2Health News:Progene Is Doctor Recommended Nationwide 2Health News:Progene Is Doctor Recommended Nationwide 3Health News:North York Dental Provides Dental Services to Busy Professionals 2
Other Tags
speedycootsovulationperimenopausalpeeksgenesystemsstrepasidewallsbumpdegradationimmunitiesbrandedpolymerpurduesexes