Tag: "white" at medical news

Duke Study Suggests New Class Of Drugs Could Bypass Leptin Loop

...of the leptin "feedback"loop. The loop begins with white fat cells, or undesirable fat. As the bodyaccumulates white fat, more and more leptin is secreted into the bloodstream,essentially signaling the body to slim do...

Use Of Surfectant Therapy Widens Gap In Death Rate Of Black And White Newborns

... 41 percentdecrease in the death rate of premature white infants. The researchersfound no change in the dea...ies' lack of access to surfactant,though premature white infants in the study were significantly more likelyto receive surfactant therapy than their black co...

Fertilization Protein Structure To AID in Leukemia Treatment

...rine mollusk and a protein on the outside of human white blood cells. The work is published in the Novembe... to synthesize the messenger. In leukemia, white blood cells have a signaling protein, called CD38, which in normal cells is only present in early st...

New Test May Improve Treatment Of Kidney Disease

...ide some answers to the puzzle. By harvesting white blood cells from patients, placing the cells in ti... work best for each patient. If a patient's white blood cells are suppressed by the medications, it ishoped that the patientwill respond favorably to ...

Cardiovascular Costs, Deaths Projected To Rise In 1998

... - was 27.5 for black females and 20.5 percent for white females.The death rate per 100,000 persons for cor...art disease was 81.6 for blackfemales and 60.3 for white females. Q/nmr/1998NewYearRelease/fw...

Study Finds Incidence Of Stroke Over 40 Percent Higher Than Previously Stated Figures

...ramingham, Mass., populations, which are primarily white and whosesocio-economic status is relatively high,...7 percent higher for black males, when compared to white males, and71 percent higher for black females than for white females, according to theAmerican Heart...

Snipping Inflammation In The Bud; New Agents May Provide Relief

...d Kiessling. "The many copies of L-selectin on the white blood cellsurface bind with the many copies of the L-selectin-binding protein on the bloodvessel, much like fingers fitting into a glove. The inflammatory responsedepends on the cells sticking together." The traditional approach to controlling inflam...

X-Rays: How Big A Risk To Kids? UF Researchers Seek Answers

...Children's Miracle Network. -30- Color or black & white photo available with this story. Forinformation, please call News & Public Affairs photography at (352) 392-9092....

Earliest Warning Sign Indicates Need To Test For Condition Associated With Fetal Deaths

...l indicators -- including maternal fever, elevated white cell count, uterine tenderness, foul-smelling discharge and increased fetal heartbeat -- were considered necessary to justify screening for chorioamnionitis, Gugino said. By comparing patient records during the pregnancy with results o...

States Must Be Held Accountable For New Health Plans For Children

...nic children is uninsured, compared with one in 10 white children. The problem has been exacerbated in the last decade by changes in the benefitsthat employers provide for their workers. The percentage of children who arecovered by employer-based insurance has declined in the past decade; thisdecline ha...

Study Reveals Possible Clue For Racial Differences In Prevalence Of High Blood Pressure

... for blackmen is about 356 percent higher than for white men. For black women, the deathrate was 344 percent higher than for white women. The finding is important, says Panza, because it identifies a potentiallysignificant contribu...

OHSU Scientists Begin Human Trials Of A Drug Aimed At The Underlying Cause Of Chronic Myelogenous Leukemia

...n increases the enzymatic activity that drives the white cells toproliferate uncontrollably, inducing leukemia. Essentially, there are no brakesto stop the proliferation. The investigational drug inhibits the enzymatic activity of the renegadeBCR-ABL protein. Called a tyrosine kinase inhibitor, the...

Scientists Report Cancer Fighting Drug As Possible Treatment For Multiple Sclerosis

...underlie these symptoms. Patchy inflammation inthe white matter of the CNS historically is called plaque. In the inflammatorymilieu of the plaque, the nerve fibers are stripped of their myelin. In the study, the researchers used inbred mice that were immunized to develop adisease called chronic-relapsing ...

Black Teen-Agers With Severe Asthma Are Three Times More Likely Than White Teens To Be Steroid Resistant

... Black teen-agers are three times more likely than white teen-agers tohave steroid resistant asthma, research at National Jewish Medical and ResearchCenter has found. "Our results suggest that children with steroid-resistant asthma are more likelyto be African-American, to have required treatment with oral...

DNA-Based Cancer Vaccine Shows Promise To Successfully Treat Melanoma In Mice

.... The condition, called vitiligo inhumans, caused white patches to develop on the mice's otherwise dark coats offur. Vitiligo occasionally develops in melanoma patients and may be indicativeof a good outcome. "Our goal was to induce a very controlled autoimmune response that would lead toprotection ag...

Study Shows Efavirenz Promising In Treating Pediatric HIV Infection: Leads To Approval Of New Drug For Testing HIV-Infected Children

...eutrophils (8.8 percent), a type of white blood cell. The percentage of participants whose HIV RNA was less than 400 copies/ml was 3.5 percent at baseline, 51.9 percent at the second week, 60.0 percent by the fourth week, 75.0 perce...

Steroids May Reverse Loss Of Substance Tied To Nervous-System Diseases

...d neuroscienceprogram at the U. of I. Myelin is a white substance made of fat and proteins that forms in aprotective spiral sheath around the axon of nerve fibers. The sheath isa vital component of the body's efficient and rapid nerve-communication system. When myelin fails to form, nerve signalingbrea...

University Of Florida Researchers Hope To Ease Asthma Pains And Provide A Sigh Of Relief

...s@qtp.ufl.edu Photo Available : Color or black & white photo available with this story. For information,please call News & Public Affairs photography at (352) 392-9092....

Exercise Can Help To Exorcise Stroke Risk

...ion existedbetween physical activity and stroke in white men, Lee says that theimplications of the research are likely applicable to women and minorities. Aprevious study in northern Manhattan had shown similar findings in women andminorities. The Harvard Alumni Health Study started in 1962 as researchers...

New Short-Acting Anesthetics Cut Recovery Time

...ouldrather see Mom than some stranger like me in a white coat," said Apfelbaum. Older people are particularly concerned about losing control andindependence, even temporarily, he added, and appreciate regaining fullawareness and mobility quickly after surgery. Many surgical procedures today are performed w...

1 2 3 4 5 6 7 8 9 10

(Date:4/17/2014)... PLOS Pathogens , children who live in regions of ... immune response to infection with malaria parasites that may ... and illness and partially control the growth of malaria ... develop future interventions that prevent or mitigate the disease ... 200 million cases of malaria occur worldwide, resulting in ...
(Date:4/17/2014)... Two recent papers by a University of Colorado ... scientists develop treatments or vaccines for Dengue fever, ... other disease-causing flaviviruses. , Jeffrey S. Kieft, PhD, ... the School of Medicine and an early career ... colleagues recently published articles in the scholarly journals ...
(Date:4/17/2014)... biology team has created a new technology for ... could travel the body and selectively target cancer ... biological devices that monitor and modify human physiology ... However, no existing technology enabled bioengineers to build ... and respond in a customized fashion. , "The ...
(Date:4/17/2014)... estimated that as many as 10 million older Americans ... loneliness and isolation. , However, new research a ... older Americans for six years found that Internet ... depression by more than 30 percent. , "That,s a ... University professor of telecommunication, information studies and media who ...
(Date:4/17/2014)... 17, 2014 By discovering a new mechanism that ... stroke, researchers at UC Irvine and the Salk Institute ... limit or prevent stroke-induced brain damage. , A complex ... of death and primary reason for disability in the ... stroke and lets blood-borne material into the brain, causing ...
Breaking Medicine News(10 mins):Health News:Study sheds light on how the immune system protects children from malaria 2Health News:CU researchers discover target for treating dengue fever 2Health News:Building 'smart' cell-based therapies 2Health News:Internet use can help ward off depression among elderly 2Health News:Study IDs new cause of brain bleeding immediately after stroke 2
Other Tags
architectsbeaverrunawaycaspaseclindamycinplentifulpertussisimmunogenicityallergenillnessessupplementsherbalprofessorshipbassetspaceddocument