Tag: "aids" at medical news

Drug Prevents Hearing Loss Caused By Brain Tumor Therapy

...arboplatin prior to the STS trials requiredhearing aids following their therapy he noted. "If you're in a quiet room, hearing loss in the high frequency range isnot a big problem, but if you have background noise, high frequency hearing losssignificantly impairs communication." After an ...

Remembering Your Medications: Older Are Wiser

...ir medications on time, Park suggests using memory aids like writtenreminders or beeping wristwatches....

Tiny Pellets Could Deliver Alzheimer's Drugs

...etylcholine. A neurotransmitter is a chemical that aids the transmission of nerve impulses. Cells close to the NGF pellet had enzyme production 100 percent greater than rat brain cells without the implanted pellet, Saltzman reports. However, the researcher says, the NGF molecules penetrated only about 1...

Magnetic Hearing Aid Could Open New "Window" For Hearing Impaired

...r the high-pitched "squeal." "Conventional hearing aids are essentially a microphone, an amplifier and asp...And like those systems, he added, acoustic hearing aids aresusceptible to feedback. With feedback, the microphone picks up much of the sound produced from...

Brain Tumor Support Group Meeting Scheduled At Cedars-Sinai Maxine Dunitz Neurosurgical Institute

...otional, psychological andeducational support that aids participants in their efforts toward recovery andgreater quality of life. Following Dr. Zeltzer's presentation, attendees will split into two groups --one for patients and the other for family members, caregivers and significantothers. These groups a...

Duke Doctors Can Now Cure Most Babies Born With Fatal Immune Disease

...their complications,"said Buckley. Buckley aids the recovery of her patients by bolstering them withapproximately 20 times the amount of bone marrow stem cells than other centersdeliver, a technique that speeds their ability to "grow" an immune system fromtheir donor cells. What has lagge...

3-D echocardiography reduces examination times and dramatically improves accuracy of the most common diagnostic test for heart function

...acy of theirdecisions. The additional information aids in determining the degree of heartfailure or wall damage. With this information, physicians can determine if thepatient's heart would benefit from cardiac bypass surgery, or is strong enoughto withstand chemotherapy if the patient needs it to treat ...

Red wine can help maintain immune system, UF researcher finds

... she has not yet pinpointed whichspecific compound aids in maintaining normal immunity. The rich pigment in red wine is due to antioxidants and blood tests showed thatmice who drank wine had two times more antioxidant capacity than the animals whodrank ethanol or water. Percival used cabernet sauvignon an...

American Home Products announces FDA approval for Sonata (Zaleplon): A breakthrough approach to treat insomnia

...culty falling asleep, manypeople do not take sleep aids for fear of next-day grogginess," says Dr. Roth. "Now, we have a medication that can be taken on an as-needed basis to helppeople get the sleep they need, while reducing the likelihood of those next-dayeffects." The Impact of Insomnia Insomni...

Vegans likely short on calcium, experts say

...ods differently. For example, the vitamin Din milk aids in calcium absorption, but spinach, which is high in calcium, alsocontains oxalic acid, which binds with the calcium and prevents the body fromabsorbing 95 percent of it. Foods with high levels of sulfur amino acids, suchas cereals, nuts and seeds, a...

BioMed Central -- freedom of information for the science community

...minatingtheir work by providing specially-designed aids to submission * use web technologies to speed up the peer review process so that itwill take days rather than months * make all articles published through BMC available immediately and infull, through the PubMed Central research archive * allow group...

Common hearing test for newborns may be wrong up to a third of the time

...guage and speech skills. But those who get hearing aids or cochlear implants early because of an in-hospital test or an alert pediatrician can often progress normally. As a result, a 1993 National Institutes of Health report and a 1995 joint commission endorsed universal newborn screening. More than 30 st...

Deaf children who get cochlear implants earliest get the biggest language boost, large study finds

...who do not benefit from amplification with hearing aids should get cochlear implants as early in life as possible. Researchers in childhood development have consistently found that toddlers and young children reach crucial milestones in speech and language development early in life. The new study's result...

License agreement signed to commercialize intelligent hearing aid

...ted to the work. "Todays state-of-the-art hearing aids can select a voice in a crowd by applying highly directive microphones," said Albert Feng, a UI professor of molecular and integrative physiology and leader of the Beckman team. "However, these devices cannot effectively differentiate between backgr...

Fourth annual HIV Vaccine Awareness Day honors volunteers for their selfless contributions to HIV research

... vaccines are the world's best hope for ending the aids epidemic. Friday, May 18, commemorates the Fourth Annual HIV Vaccine Awareness Day, which honors thousands of volunteers worldwide who have literally rolled up their sleeves to receive an experimental vaccine designed to prevent HIV infection in stu...

Dartmouth research examines the value of cancer screening

... analogy popular among his peers. Instructions and aids to protect yourself from a shark attack are meaningless if you dont go in the water. Similarly, people have to understand how likely they are to be at risk for certain cancers when they decide to be screened for them. "They should be asking thei...

New book aims to keep elderly drivers on the road

...nd which states accept their use. It details such aids as bioptic telescopes, mounted on glasses, to help... locally) and gaining some experience using visual aids before going for an eye or driving test. "With the population of older drivers constantly growing, w...

Patient leaflets may not be effective in the real world

... care, say the authors. They suggest that decision aids may not be effective in the real world. Within the same study, Helen Stapleton and colleagues found that time constraints and other pressures on health professionals resulted in a lack of discussion of the content of the leaflets. Health professional...

Teaching computers to replace lost sounds

...tion between the airport and the airliner. Hearing aids could connect to a chip and work in the same fashion. Savic envisions that the technology would be useful to historians as well and would not be relegated to sound analysis alone. Anything that has a pattern to it could benefit from the technology. ...

Poor hearing common among elderly people in the UK

...ced hearing is common-and the provision of hearing aids inadequate-among elderly people in the UK, conclud...hlights how many elderly people do not use hearing aids regularly, and that socially disabling hearing loss is common even when hearing aids are used. Heari...

1 2 3

(Date:8/23/2014)... The MPWMD Board of Directors voted on Monday, August 18th ... of water for commercial and industrial properties. This was ... Archworks, LLC in Carmel, California. , This is a ... district in the State of California has approved this technology ... this time can now be used as a sole source ...
(Date:8/23/2014)... Professional kitchen employees, prospective chefs and food ... for Food Safety Certification exams thanks to the free ... , Dynamic Path announced the release of its Food ... review questions for culinary industry students and professionals. ... of the ServSafe® Food Safety Certification, National Registry of ...
(Date:8/23/2014)... 2014 Pixel Film Studios, a leader of ... release of ProIntro Vol.3, a customizable title tool for ... tile just by dragging ProIntro Vol.3 in their timeline" says ... a definite time saver and i think our users will ... beautifully designed titles made with Final Cut Pro X users ...
(Date:8/23/2014)... Young adults in Athens, GA who find that they ... the phone and call the new helpline which can offer support ... , Troubled Teen Athens is a wonderful resource for an adolescent ... necessary steps to end substance abuse once and for all. When ... friends or peers when really they should put their faith in ...
(Date:8/23/2014)... Dealing with a drug or alcohol substance abuse ... is a child. Adolescent addiction has been an important issue ... a new helpline is now providing a valuable resource for ... a real addiction recovery center. , The Troubled Teens Atlanta ... the community. By calling (404) 975-2762, parents and their teens ...
Breaking Medicine News(10 mins):Health News:Historical Moment in the Monterey Peninsula, Brings Drought Relief Solution to California, with the Help of EcoloBlue and AWG Technology 2Health News:Food Handler Safety Certification Made Easy with Dynamic Path 2Health News:A new plugin was announced today, ProIntro Vol.3 from Pixel Film Studios for Final Cut Pro X 2Health News:Teenagers in Athens, GA are Locating Addiction Recovery Thanks to New Helpline 2Health News:Atlanta’s New Troubled Teen Helpline Is Making a Difference in the Community 2
Other Tags
hatchedmurreletmarbledswarmseelgrassisotronspaceswhiffiestdevicewidelyisraelilaunchvanasmebioengineerafraid