Tag: "alert" at medical news

Study Says Machine Sensors Applicable To Human Ills

...ospital," Hall says.The constant surveillance will alert physicians as soon as a patient becomesat risk so that they will be able to intervene in "the golden 20 minutes"when drug therapy can be most effective. Penn State's ARL, a Navy-oriented facility, was chosen to lead the PredictiveDiagnostics Team b...

Cardiovascular Costs, Deaths Projected To Rise In 1998

...cludes a section to tiein with the AHA's effort to alert women of the dangers of heart disease andstroke. It reports that in the United States since 1984 more women have diedeach year of cardiovascular disease than men. Final mortality data for 1995shows that the death rate per 100,000 persons for breast c...

Modafinil Improves The Quality Of Life Of Narcolepsy Patients

...ents treatedwith modafinil in this study were more alert and their ability to perform usualactivities was s...g sports ordriving. Many patients are never fully alert and cannot function normally. Thedisorder can take an emotional toll on its victims who are often m...

Safe And Effective Treatment For Acute Repetitive Seizures

...ians and family members because thepatient must be alert in order to swallow. "This is a safe and effective way of addressing an urgent health condition andone that enables flexible, convenient treatment outside of a hospital or clinic,including the patient's home," says Dr. Sheridan. "This trial is a st...

Mostly In The Mind

...rstein are right to point out that sideeffects can alert a patient in a trial to the fact they are getting an activedrug rather than a placebo. "If patients know they're getting treatment, theirexpectation will be raised and with it their optimism that they will get better.It's a self-fulfilling prophecy."...

Forecasting Killer Heat: UD Systems Predict Deadly Weather Worldwide

...bute mediaadvisories, activate telephone hotlines, alert neighborhood volunteers, openair-conditioned shelters, expand outreach to the homeless, coordinate effortswith local utilities or take other actions, depending on the level of riskpredicted by UD's warning system. In Washington, D.C., the Office of E...

Interleukin-2 Boosts Cancer Vaccine Effectiveness In Mice

...ed white blood cells called dendritic cells, which alert the body'simmune system to the presence of cancer.... with advanced metastaticmelanoma. Dendritic cells alert the immune system to cancer by presenting pieces ofdigested tumor proteins called antigens to white ...

Low-Tech Treatment Proves A Life-Saver In Research Breakthrough

...sful that it has been stopped ahead of schedule to alert critical carespecialists of the life-saving results, said Michael Matthay, M.D., professor ofmedicine and anesthesia at UC San Francisco and a principal investigator in theten-city study funded by the National Institutes of Health. "This is the first...

For Breast Self-Examination, Once A Month Is Quite Enough

...y. Current health promotion efforts seek mostly to alert and motivate at-risk womenat the low end of the self-examination scale. For the high-end self-examiners,these programs need to be broadened to include the message that daily or weeklyexaminations may not improve cancer detection, the researchers sai...

Patients Treated Successfully For Hodgkin's Disease Are At 9 Times The Risk For Developing Second Cancer

...or researcheron the studies. "These studies should alert physicians to the need for carefuland continuing screening at a much earlier age than the American Cancer Societyrecommends for the population at large." The studies involved 182 patients treated at RPCI for Hodgkin's diseasebetween 1960 and ...

Full bone mass restored to most postmenopausal women with osteoporosis in two-year trial of new treatment

...lly finding in rats, Arnaud says, "should serve to alert us to becautious as we proceed toward further development of parathyroid hormone as apowerful treatment for established osteoporosis in older adults." One of the first goals, he said, is to confirm that the large increase in bonemass induced by the h...

Allergy-producing cells are also 'do-gooders,' helping stave off infections

... as Salmonella and dangerousstrains of E. coli and alert the immune system to destroy the bacteria. ...a. This CD48-FimH connection triggers mastcells to alert the immune system by releasing a substance called tumor necrosisfactor alpha (TNF-a), which is a typ...

Children's inability to automatically retrieve building blocks of language, math leads to learning disabilities in reading, writing, arithmetic

...ignal. Many of these becomeautomatic so we can be alert to other drivers and conditions on the road," saysBerninger. "This is why we start by learning to drive in an empty parking lot andnot on the freeway with all of its complexity, "adds Busse. "To be good atreading, writing and mathematics we a...

Mitral valve repair at Cedars-Sinai Medical Center gets Los Angeles dentist on the road to recovery

...r recovery. "The evening after my operation, I was alert and experiencing no pain," said Dr. Bredberg. "During my hospital stay, they kept me up walking and exercising to prevent the tissue from scarring." A month after surgery, Dr. Bredberg had already officiated at a wedding and was looking forward to re...

Statement from Dr. Claude Lenfant, director, NHLBI and Dr. Phillip Gorden, director, NIDDK

...rganizations on a major public health statement to alert physicians, patients,and the general public to the increasing significance of diabetes mellitus as amajor risk factor for cardiovascular disease. In joining this effort, eachorganization reaffirms its commitment to better understand the causes and un...

Jefferson scientist sees drug profiles and tailor-made therapies as ways to beat HIV resistance

...editorial, he recommends medical officials be more alert tomultidrug resistance. "If you give a patient a cocktail of drugs the first timeand they don't respond, and you can't find it's from noncompliance, you have tothink they have primary resistance." Eventually, all patients may need to be profi...

UCSF finding could lead to a new class of painkillers

...w molecular pathway through which chemical signals alert the body to pain, and inhibiting the key protein i...turb basic pain-sensory thresholds, needed to help alert the body to possible danger, and the mice in which the enzyme was missing appeared normal, it may be...

Depression linked to death among heart failure patients

...est that health professionals should be especially alert to depression in congestive heart failure patients and should strive to provide appropriate treatment for depression when needed." Participants in the study included 119 clinically stable patients with congestive heart failure who attended the outpat...

Club drugs take center stage in new national education and prevention initiative by NIDA and national partners

...aunched a multi-media public education strategy to alert teens, young adults, parents, educators and others about the dangers of club drugs such as Ecstasy, GHB and Rohypnol, which are often used at all night raves or dance parties and have potentially life-threatening effects. Club drugs are not harmle...

FDA approval means Americans with osteoarthritis have a new option

...g symptoms. Patients and physicians should remain alert to the earliest signs and symptoms of gastrointestinal bleeding. For additional information regarding MOBIC tablets, including the full prescribing information please visit http://www.MOBICtablet.com . *CELEBREX is a registered trademark of G. D. S...

1 2 3 4 5 6

(Date:11/23/2014)... BambooFlooringChina.com , the world’s leader in bamboo flooring, ... flooring collection. Now, the business is announcing big discounts ... promotion is valid until Dec. 20, 2014. , The new ... dust-free surface, which makes it very easy to maintain. As ... wants to make its website the best shopping platform for ...
(Date:11/22/2014)... (PRWEB) November 23, 2014 Cancer researchers ... a connection between intercellular communication tunnels and the growth ... the full story on the Surviving Mesothelioma website. ... and the University of Minnesota have just released their ... information and materials between cells. They found that ...
(Date:11/22/2014)... Recently, Locks-Magnetic.com , one of the successful electrical ... locks for glass doors online. In addition, the company ... products. Customers can get more information on its website. ... excellent performance. Customers who want to buy this new ... They also can enjoy the one-stop shopping experience. ...
(Date:11/22/2014)... PA (PRWEB) November 22, 2014 “Due to ... said an inventor, from Gurnee, Ill. “While using the ice ... be and I thought there needed to be a safer ... invented the SPIKE BLOCK. , The SPIKE BLOCK offers added ... so, it would help to reduce injuries and damage associated ...
(Date:11/22/2014)... PA (PRWEB) November 22, 2014 "My ... the pain caused by the machine," said an inventor ... she had to go back a second time because ... invention idea." , She developed the patent-pending MAMO EASY ... breast cancer. The design saves the patient from the ...
Breaking Medicine News(10 mins):Health News:Click Strand Woven Bamboo Flooring From Famous Bamboo Flooring Company BambooFlooringChina.com 2Health News:Study Links Cellular ‘Tunnels’ to Mesothelioma Proliferation, According to Surviving Mesothelioma 2Health News:Discounted Mag Locks for Glass Doors Revealed by Locks-Magnetic.com 2
Other Tags
bloomduecorpsesmellyvalvesimplifyarisingschrenkinsurancecirrhosiscelecoxibtooculpritfindresearchersstanford