Tag: "animal" at medical news

Why prostate cancer homes to bone

...nother theoryportrays cancer more like a predatory animal that is drawn by the trail of itsfavorite prey. Drs. Karin Jacob and Hynda Kleinman from NIDCR's Craniofacial DevelopmentalBiology and Regeneration Branch led an international research team to determineif there was a specific factor in bone that acts...

New MicroPET scanner would be second in country

...ioral disorders associated with chronic disease in animal models....

UCSF to attack HIV at molecular level with new center and $7 million in state funds

...rough a vaccine. One of the projects will focus on animal testing of a new vaccine concept,while the others will investigate how to begin to develop vaccines against HIVto work both in those who are infected and in those who are uninfected. UCSF was one of the first institutions in the world to document the...

UCSF finding could lead to a new class of painkillers

...to previously innocuous stimuli. As a check on the animal study results, the researchers examined whether inhibiting PKC would blunt epinephrine's action in pain-sensory neurons in laboratory cultures. It did. In cultured cells in which the enzyme was inhibited, epinephrine's effect was decreased by half, d...

U-M School of Public Health to direct national asthma program

...o allergens such as house dust-mites, cockroaches, animal dander,tobacco smoke and mold can reduce the frequency and severity of asthma attacks. The Robert Wood Johnson Foundation is the nation's largest philanthropy devotedexclusively to health and health care....

Novel photonic material developed at UB reveals how human breast-cancer cell takes up anticancer agent

...and possibly others as well. AN-152, now in animal trials, first was synthesized by Andrew V.Schally, Ph.D., M.D.h.c., 1977 Nobel laureate in medicine and director of theEndocrine, Polypeptide and Cancer Institute of the Veterans Affairs MedicalCenter in New Orleans, and Attila Nagy, Ph.D., associate...

Study spotlights uniqueness of human brain

...etweenhumans and other animals in order to develop animal models of disease. And,there are many similarities between the brains of humans and other animals. Butwe need to study the differences, too, so we can begin to understand what'struly distinctive about the human brain and human mind." Povinelli cal...

MGH researchers identify angiogenesis inhibitor in gallbladder cancer

...lbladdercancer. They also report finding that, in animal studies of the development ofblood vessels (angiog...ulature [blood vessels]of tumors using specialized animal models." In the first step of their study, the research team implanted human gallbladdercarcinoma ce...

Estrogen may play role in prevention of cataracts

...old risk ofdeveloping cataracts. "We now have an animal model system that will allow us to determine if thedifferent types of estrogens used in post-menopausal hormone replacement therapywill also prove protective against cataracts," Dr. Bigsby said....

NIAID spearheads collaborative network for clinical research on immune tolerance

...nce have shownpromising results in both laboratory animal models and early human clinicalstudies. Network researchers will accelerate testing of these and othertolerogenic approaches, and will develop and evaluate methods to monitor theinduction, maintenance and loss of immune tolerance in humans. "We have ...

National Cancer Institute awards UNC-CH $5 million for unique prostate cancer studies

...ophisticatedanalysis of genes and proteins in both animal and human samples through a systemrelying on standard and fluorescence microscopy and image analysis usingsoftware developed at UNC-CH to measure molecules of interest in prostatetissue. "In this country, almost 40,000 men are still dying of ...

Researchers discover potential new approach to treating cystic fibrosis

...."They've made some tantalizing observations in an animal model," said PeterDurie MD, director of cystic fibrosis research at The Hospital for Sick Childrenin Toronto, where the cystic fibrosis gene was discovered 10 years ago. "Nocurrent therapy for cystic fibrosis deals with the underlying problem. Potent...

Young children who are in regular contact with farm animals are less likely to develop allergies later in life

... in life. Thishas been reported for pollen and for animal dander. In the light of the presentreport, it is therefore important to establish whether there are bacterialproducts or antigens from stables that may be effective in protecting againstlater sensitisation for children raised on farms. It should not ...

Yale receives $10 million to study tobacco use: Research grant comes from three national organizations

... these issues frommultiple perspectives, including animal models of nicotine dependence andmolecular studies, human laboratory research, brain imaging techniques, andclinical trials. In this respect, O'Malley says, the center has breadth in the tools andperspectives that will be applied to the research and...

Federal institutes and the Robert Wood Johnson Foundation create Tobacco Use Research Centers

...e range of studies that include culture, genetics, animal models ofbehavior, and innovative treatments. Investigators will study the prevention oftobacco use, initiation of tobacco use, and addiction. Tobacco-related diseasecauses more than 450,000 deaths each year, including 170,000 cancer deaths. ...

Duke team seeks novel vaccine strategy for HIV

...s limitations. So the researchers developed aSHIV animal model by combining human and monkey AIDS viruses to create a newvirus that expresses a HIV envelope on the "backbone" of SIV. Both the SIV andSHIV models will be used in the current project. "HIV is making us look at vaccines in a totally ne...

To build a better artificial hip, UD prof says, mimic Mother Nature

... seekingpatent support. They also hope to complete animal studies with sheep at the NewBolton Veterinary Hospital of Pennsylvania, he adds. Support for the UD research was provided by the Whitaker Foundation. Along withSantare and Advani, the team included postdoctoral researcher Makarand G. Joshiand gradua...

Northwestern researchers present findings at Neuroscience Meeting

...e therapy is effective, it must be tested inlarger animal models of Parkinson's disease. In addition, improved and safermethods of inserting genes into the brain must be developed. The Northwesternresearchers are pursuing both avenues of research. Bohn can be reached during the Neuroscience Meeting at m-b...

Soy substances slow prostate cancer growth in animals

...h of prostate cancer, a new animal study has shown. But cancer researchers warn against rushing to use them as diet supplements. The finding suggests that substances known as soy isoflavones are probably responsible...

Studies of growth hormone result in new class of drugs

...e, where Kopchick is a senior scientist. Human and animal growth hormones contain a chain of 191 amino acids...breast cancer. His research team now is conducting animal studies of the growth hormone antagonists' ability to halt the progression of diabetic nephropathy a...

1 2 3 4 5 6 7 8 9 10

(Date:4/17/2014)... PLOS Pathogens , children who live in regions of ... immune response to infection with malaria parasites that may ... and illness and partially control the growth of malaria ... develop future interventions that prevent or mitigate the disease ... 200 million cases of malaria occur worldwide, resulting in ...
(Date:4/17/2014)... Two recent papers by a University of Colorado ... scientists develop treatments or vaccines for Dengue fever, ... other disease-causing flaviviruses. , Jeffrey S. Kieft, PhD, ... the School of Medicine and an early career ... colleagues recently published articles in the scholarly journals ...
(Date:4/17/2014)... biology team has created a new technology for ... could travel the body and selectively target cancer ... biological devices that monitor and modify human physiology ... However, no existing technology enabled bioengineers to build ... and respond in a customized fashion. , "The ...
(Date:4/17/2014)... estimated that as many as 10 million older Americans ... loneliness and isolation. , However, new research a ... older Americans for six years found that Internet ... depression by more than 30 percent. , "That,s a ... University professor of telecommunication, information studies and media who ...
(Date:4/17/2014)... 17, 2014 By discovering a new mechanism that ... stroke, researchers at UC Irvine and the Salk Institute ... limit or prevent stroke-induced brain damage. , A complex ... of death and primary reason for disability in the ... stroke and lets blood-borne material into the brain, causing ...
Breaking Medicine News(10 mins):Health News:Study sheds light on how the immune system protects children from malaria 2Health News:CU researchers discover target for treating dengue fever 2Health News:Building 'smart' cell-based therapies 2Health News:Internet use can help ward off depression among elderly 2Health News:Study IDs new cause of brain bleeding immediately after stroke 2
Other Tags
architectsbeaverrunawaycaspaseclindamycinplentifulpertussisimmunogenicityallergenillnessessupplementsherbalprofessorshipbassetspaceddocument