Tag: "announce" at medical news

HHS announces contracts for developing a new anthrax vaccine

...rformance criteria. In Spring 2003, NIAID plans to announce a new competition for one company to be chosen to manufacture and maintain the 25-million dose emergency stockpile. Consideration for this subsequent manufacturing contract will be competitive and not limited to the two companies awarded contracts to...

LOral USA launches new science fellowship program

...t and Palestine. "We are very proud, to be able to announce that L'Oral USA will expand its commitment to promoting the role of women in the scientific community, through the establishment of these fellowship awards", said Jean-Paul Agon, President and CEO....

Brady announces collaborative grant to develop radiation injury treatment

...ng its review of additional proposals and plans to announce further cooperative research awards in the near future. The U.S. Civilian Research and Development Foundation is a private, nonprofit organization authorized by the U.S. Congress and established by the National Science Foundation in 1995. The CRDF s...

Tylenol awards $250,000 to outstanding healthcare students

...0, 2003 -- The makers of Tylenol(R) are pleased to announce the winners of the 2003 Tylenol Scholarships. This year's grants total $250,000, including 10 grants of $10,000 each and 150 of $1,000. "The future of healthcare is a priority for us, and we are very proud of the accomplishments and dedication of th...

The statin wars: Why AstraZeneca must retreat

...the world's largest pharmaceutical companies, will announce its third-quarter financial results. This coincides with a robust editorial in this week's issue of THE LANCET which calls into question AstraZeneca's high-profile marketing of rosuvastatin, a drug launched into the global statin market last month on...

Cardiff universities to merge

... and prosperous Wales. I am pleased to be able to announce the Assembly Government's financial support for the Cardiff Merger, which clearly demonstrates the Assembly's commitment to funding reconfiguration and realising the benefits of collaboration. I look forward to further proposals coming forward from ...

Roche files marketing application for Avastin with European health authorities

...n developed countries. 1 "We are delighted to announce the submission for marketing authorisation of Avastin in the European Union," said William M. Burns, Head of Roche Pharmaceuticals Division. "Roche is dedicated to the development of safe and efficacious treatments for many types of cancers, and we ...

The American Heart Association's new guidelines for cardiovascular disease prevention in women

... Mark.Hurley@heart.org WHAT: News conference to announce publication of: The American Heart Association's ...fet breakfast 9 10 a.m. EST News conference to announce guidelines, survey results and "Go Red for Women" campaign. WHERE: New York City Marriott East S...

ESC in partnership with EU to strive for European consensus on CVD treatment and prevention

...isease across Europe. Now the ESC is delighted to announce that the Irish Presidency of the EU has taken up the challenge by placing cardiovascular disease top of its health agenda and working with the ESC to strive for European consensus on cardiovascular disease treatment and prevention. Cardiovascular di...

76 million research centre to make the UK a global centre of excellence for clinical imaging

...SmithKline (GSK) and Imperial College London today announce a unique research collaboration in medical imaging. GSK will contribute funding of 28m for the construction of a new Clinical Imaging Centre, next to Hammersmith Hospital in west London, UK. Research will focus on cancer, stroke, neurological diseas...

Tropical medicine: A brittle tool of the new imperialism

...ship forum" three years after opening its doors to announce yet another opaque system of rich-world patronage. Third, physicians should protest against policies that hurt efforts to improve the health of the poor, such as the discriminatory US trade embargo on science editing (see p 1160). And finally, resear...

Diet of worms protects against bowel cancer

...onfronted with new ideas," Weinstock says. He will announce the results in May at a conference in New Orleans, and full details will soon be published. "With our new impressive results, we can come out of the closet," he says. The trials follow the success of a pilot study, revealed by New Scientist in 1999 ...

LSUHSC microsurgeon performs 1st ever eyelid reattachment

...e on Monday, April 26, 2004 at 11:30 a.m. (CDT) to announce that Dr. Kamran Khoobehi, a Plastic and Reconstructive Surgeon at Louisiana State University (LSU) Health Sciences Center in New Orleans, has made medical history by reattaching the right upper eyelid that had been ripped off as the dog of a 22-year...

Tony Blair launches UK's new global AIDS strategy

...e to AIDS in the developing world and I am glad to announce $280.3 million (150m) towards international efforts to support and protect orphans. I am also announcing a further $144 million (77m) for the Global Fund to fight AIDS, TB and Malaria to help fight these three diseases that thrive on poverty." ...

New class of compounds promises to revive failing hearts

...ted by the debilitating condition. Scientists will announce their results in late August at the American Chemical Society's annual summer meeting, held this year in Philadelphia. "Our results are preliminary, but very promising," said John P. Toscano, professor in the Chemistry Department in the Krieger Schoo...

New compounds show promise in fighting malaria and cancer

...ld standard" drug treatments. Scientists will announce their successful results in late August at the American Chemical Society's annual summer meeting, held this year in Philadelphia. Some of the results also appeared in the January 2004 issue of the Journal of Medicinal Chemistry. "Preliminary data sho...

NYU Child Study Center to launch Healthy Kids, Happy Futures

...al Emergency Management Agency (FEMA) are proud to announce the release of Healthy Kids, Happy Futures, a pediatric education campaign. With support from Project Liberty, the program aims to assist pediatricians in becoming more proficient in identifying signs of trauma and other mental health problems in ch...

PCRM asks ACS to cancel fundraisers

...ask for the caller's name and affiliation and will announce this information once all the callers have joined the press conference. The caller will then be able to listen in to the telephone conference, but will not be able to ask questions until the Q&A following the prepared remarks is announced. ...

Journal of Alzheimer's disease to publish ISOA Catalyst Conference

...the Study of Aging (ISOA), IOS Press is pleased to announce the forthcoming publication of the Proceedings of an ISOA Catalyst Conference as a special print and online Supplement to the December 2004 issue of the Journal of Alzheimer's Disease (JAD). "JAD and IOS Press are honored to be working with ISOA, on...

Senators Lautenberg and Corzine secure $1 million to accelerate smart gun development at NJIT

...erg (D-NJ) and Senator Jon S. Corzine (D-NJ), will announce tomorrow that they have secured $1 million in federal appropriations funding for 2005 to accelerate the development of a safer and more secure personalized handgun at New Jersey Institute of Technology (NJIT). The senators secured similar funding la...

1 2 3

(Date:4/18/2014)... scientists could lead to potential new treatments for breaking ... , Fibrosis, or scarring, is a hallmark of ... lungs can lead to serious organ damage and, in ... options centers on findings made by Swati Bhattacharyya, PhD, ... that a specific protein plays in promoting fibrosis. ...
(Date:4/17/2014)... popular vaccine brands for children may not be the ... cost factors when choosing vaccines, driving the market toward ... a new study by University of Illinois researchers. , ... by numerous factors," says Sheldon H. Jacobson, a co-author ... and of mathematics at the U. of I. "In ...
(Date:4/17/2014)... NY In a review published in the April ... president of The Feinstein Institute for Medical Research, says ... medical community,s approach to treating sepsis, which ... Americans. , Sepsis occurs when molecules released into the ... throughout the body. Inflammation is necessary for maintaining good ...
(Date:4/17/2014)... many as 10 million older Americans suffer from depression, ... , However, new research a project that followed ... six years found that Internet use among the ... than 30 percent. , "That,s a very strong effect," ... telecommunication, information studies and media who led the project. ...
(Date:4/17/2014)... 17, 2014 EcoHealth Alliance, a nonprofit organization that ... a comprehensive review today examining the current state of ... review calls for improved global surveillance strategies to combat ... outbreak of Ebola in West Africa that has claimed ... Guinea and Liberia. According to the World Health ...
Breaking Medicine News(10 mins):Health News:New clues on tissue scarring in scleroderma 2Health News:Study recalculates costs of combination vaccines 2Health News:Feinstein Institute researcher publishes new perspective on sepsis 2Health News:Internet use can help ward off depression among elderly 2Health News:Re-emergence of Ebola focuses need for global surveillance strategies 2Health News:Re-emergence of Ebola focuses need for global surveillance strategies 3
Other Tags
pandoraswettergrasslandsleftieshygieniccapacitiesmusculaturemirnasawaresummitkyotoesabrachytherapyinversetemporarilysue