Tag: "anticipates" at medical news

Mechanism of RNA recoding: New twists in brain protein production

...orates both sequence and structural signals." She anticipates this work, also funded in part by the National Institutes of Health, will "greatly increase our ability to interpret the information encoded in the genome." Researchers still don't know why editing occurs, but posit that organisms use it to increase ...

Cedars-Sinai medical tipsheet for Dec. 2004

...tep-children, and two additions to the family, she anticipates her fifth tumor-free holiday season. Dr. Keith Black and the patient are available for interviews. LAB STUDY DEFINES AND BLOCKS MECHANISM THAT LETS BRAIN TUMORS SIDETRACK IMMUNE RESPONSE Because the enzyme cyclooxygenase-2 (COX-2) has been linked t...

Optics meeting tips: Internal fingerprints, no cell left behind, 3-D reality

...ch used to take five minutes per measurement. Wax anticipates that the first clinical trials in human subjects with esophageal cancer will begin in about two years. (Paper FTuR1, Tuesday, October 12, 4:15 p.m.) 3-D REALITY WITHOUT THE REAL Conventional 3-D displays force our eyes to do two c...

New therapeutic approach for sickle cell disease

... alone or in combination with existing treatments, anticipates therapies in humans that are more flexible and potentially more effective than those that are currently available for this devastating condition." Sickle cell disease affects millions of people throughout the world. It is the most common inherited ge...

Report finds inactivated influenza virus vaccines effective in children

...t, and it can prevent influenza." Dr. Ruben anticipates that, as physicians become more informed about the safety and availability of killed-virus flu vaccine, they will notify and encourage pediatric patients to get vaccinated. "Killed vaccines are the most important tool we have," said Dr. Ruben. ...

University of Pittsburgh receives two grants to try to increase organ donation/procurement

...e donors. If the device proves effective, the team anticipates more organs per donor will be deemed viable for donation and transplantation and that graft function in recipients who receive organs from donors treated with the device will be improved. Two medical centers and two organ procurement organizations ar...

Aircraft technology helps diagnose artificial hip, knee problems

... an assistant professor of mechanical engineering, anticipates using her research to create a "wear atlas" that can be used by orthopedic surgeons as a diagnostic tool. She said the atlas could be used to help identify the potential problems that patients are having with their implants prior to revision surgery...

New approach for studying traumatic injury

...large-scale, multidisciplinary pursuits. The NIGMS anticipates spending $37 million on the project. After severe trauma or stress, the body's natural defense mechanisms can trigger an often-fatal cascade of events that ends in a series of organ failures. As a result, critical illness and injury account for eight...

Brain anticipates events to learn routines

... might happen next. For example, a baseball player anticipates that the pitcher will throw the ball towards him after he winds up, because he has seen him perform this task countless times before. People in every day life also use this function of their brain each time they do something routine, like driving a c...

Aventis Pasteur donates approximately 75 to 90 million doses of smallpox vaccine to the U.S.

...culture-based smallpox vaccine in Europe, which it anticipates will become available in Europe at the end of the year. In addition, the company has proposed redirecting some of its research efforts towards the development of an improved smallpox vaccine based on its proprietary NYVAC (highly attenuated vaccinia...

Team studies use of Sandia technology to ensure 'farm-to-fork' safety of the nation's food supply

...abilities of water supplies. In the future, Drayer anticipates that other Sandia technologies will be transferred to agriculture. Already, one Sandia researcher is applying Sandias physical protection expertise to sensitive biological research facilities. The field is wide open for opportunities to use our techn...

New study of first successful targeted therapy for breast cancer launched; Thousands of volunteers sought

...s, medication can alleviate those symptoms. Slamon anticipates that it will take 18 to 30 months to screen an estimated 15,000 women, from whom 3,150 eligible patients will be identified and enrolled in the trial. Dr. Linnea Chap, an oncologist who specializes in breast and ovarian cancers, will be the principal...

Researchers at Cedars-sinai find four more genes that may play a role in the development of malignant brain tumors

...cancer and other diseases, said Dr. Ljubimova. She anticipates that within the next decade the diagnosis of diseases including cancer will move to the molecular level on a routine basis, becoming as common as a blood profile is now. Today we have about 100 parameters in a blood profile. In five or 10 years, be...

UT Southwestern Nobel laureate leads bold project changing way scientists conduct research

...NIGMS), part of the National Institutes of Health, anticipates spending a projected $25 million over the first five years to the AFCS. The federal government, pharmaceutical companies, private donors and several academic institutions are involved in the partnership and will provide additional funding during the ...

AmericasDoctor.com & Affiliated Research Centers announce merger that revolutionizes clinical trial recruitment, expedites pharmaceutical research

...Ventures of Menlo Park, Calif. The merged company anticipates raising another $10 to $15 million dollars of capital in the near term. AmericasDoctor.com, recently recognized as the only Editors' Choice in the category of health and medical Webster by PC Magazine, is sponsored by 120 of America's most prestig...

New publisher announced for Journal Of Pharmaceutical Sciences

...n the Digital Object Identifier (DOI) project, ACS anticipates that all bookmarks that make use of the DOI address will continue to be validafter the transition is complete....

Colorado State receives $6.25 million from National Institutes of Health to discover and test new drugs against tuberculosis

...ising anti-tubercular drugs each year, although he anticipates investigating perhaps twice that number. Brennan said progress toward finding effective drugs is hampered by economics, since recouping research and development costs will be difficult. "There isn't much money in tuberculosis drugs," he said. "It'...

Duke Obtains FDA Designation For Pompe Disease Therapy

...criteria. Chen, who will lead the clinical trial, anticipates that recombinantenzyme injected into infants will be taken up by their muscle cells andrestore normal glycogen levels. This treatment, known as an enzyme replacementtherapy, would be required for the rest of these patients' lives. He said he hopes t...

1

(Date:4/18/2014)... scientists could lead to potential new treatments for breaking ... , Fibrosis, or scarring, is a hallmark of ... lungs can lead to serious organ damage and, in ... options centers on findings made by Swati Bhattacharyya, PhD, ... that a specific protein plays in promoting fibrosis. ...
(Date:4/17/2014)... popular vaccine brands for children may not be the ... cost factors when choosing vaccines, driving the market toward ... a new study by University of Illinois researchers. , ... by numerous factors," says Sheldon H. Jacobson, a co-author ... and of mathematics at the U. of I. "In ...
(Date:4/17/2014)... NY In a review published in the April ... president of The Feinstein Institute for Medical Research, says ... medical community,s approach to treating sepsis, which ... Americans. , Sepsis occurs when molecules released into the ... throughout the body. Inflammation is necessary for maintaining good ...
(Date:4/17/2014)... many as 10 million older Americans suffer from depression, ... , However, new research a project that followed ... six years found that Internet use among the ... than 30 percent. , "That,s a very strong effect," ... telecommunication, information studies and media who led the project. ...
(Date:4/17/2014)... 17, 2014 EcoHealth Alliance, a nonprofit organization that ... a comprehensive review today examining the current state of ... review calls for improved global surveillance strategies to combat ... outbreak of Ebola in West Africa that has claimed ... Guinea and Liberia. According to the World Health ...
Breaking Medicine News(10 mins):Health News:New clues on tissue scarring in scleroderma 2Health News:Study recalculates costs of combination vaccines 2Health News:Feinstein Institute researcher publishes new perspective on sepsis 2Health News:Internet use can help ward off depression among elderly 2Health News:Re-emergence of Ebola focuses need for global surveillance strategies 2Health News:Re-emergence of Ebola focuses need for global surveillance strategies 3
Other Tags
pandoraswettergrasslandsleftieshygieniccapacitiesmusculaturemirnasawaresummitkyotoesabrachytherapyinversetemporarilysue