Tag: "antidepressant" at medical news

Rape Victims Find Relief From Posttraumatic Stress Using The Antidepressant Zoloft.

...Journal of Traumatic Stress. After 12 weeks on the antidepressant sertraline (Zoloft), four out of thefive women who completed the open clinical study responded positively totreatment. "Sertraline reduced PTSD and related symptoms in these rape victims," theauthors report. "The mean Clinician Administered PTSD Scal...

Drug Is First In Decade To Show Promise Treating Generalized Anxiety Disorder

...treatment for anxiety," he said."To date, no other antidepressant has been tested as extensively for use inGAD." Effexor XR is the trade name of the generic drug venlafaxine XR, ananti-depressant that boosts the brain's ability to utilize two importantmood-regulators, serotonin and norepinephrine. On the market fo...

UF Psychiatrists Use Antidepressants To Treat Smoking Addiction

...athological attachment to smoking, who are getting antidepressant effects from smoking. They love smoking; it's a source of pleasure. "The idea that you can treat all smokers with a nicotine patch or gum is not realistic," he adds. "It's like saying you've discovered the cure for all alcoholism is alcohol....

Antidepressants Can Lead To Mouth Infections

Persons taking antidepressant medication are at increased risk ofdeveloping dental cavities and oral infections, researchers warn. This is because antidepressants cause "dry mouth" by reducing theability to secrete saliva, according to F. P. M. L. Peeters, MD, and M.W.DeV...

Study Finds St. John's Wort Can Cut Alcohol Consumption

...t. John's wort already is themost often prescribed antidepressant in Germany," said Dr. Amir H. Rezvani,research associate professor of psychiatry at the UNC-CH School of Medicine. "Itis reported to be as effective as Prozac and produce fewer side effects." Rezvani presented his findings Tuesday (June 23) i...

Mostly In The Mind

The benefits of antidepressant drugs could be almost entirely due to thepsychological boost derived from taking a pill rather than their effects onbrain chemistry, say two researchers in the US. Irving Kirsch of the University of Connecticut and Guy Sapirstein ofWestwood L...

The Problem With Fen-Phen

...rtuallywiped out. Fenfluramine, like many antidepressant drugs, stops plasma serotoninfrom being taken up i...is involved in transmitting nerve impulses, andthe antidepressant and anti-obesity drugs that block serotonin uptake intoplatelets are designed to enhance this effect...

First Drug Shown Effective For Treating Chronic Forms Of Major Depression

... on placebo, a side effectcommonly seen with antidepressant treatments. The study was funded by Pfizer Inc. "The bottom line is that chronic types of depression are disabling andvastly undertreated," said Martin B. Keller, M.D., who directs the research."The study describes an effective way...

Study Finds Psychotherapy And Anti-Depressants Equally Effective In Treating Severely Depressed Primary-Care Patients

...ectiveness of treating majordepression with either antidepressant medication or psychotherapy noted nodifference in ...f varying severity that was treated with either an antidepressant medication orpsychotherapy." They suggest that future researchers should attempt todetermine whethe...

Newest Depression Medications Widely Prescribed For Children

...e reuptake inhibitors (SSRIs), the newest class of antidepressant drugs.Currently approved by the Food and Drug Administration for patients over 18years of age, SSRIs have been increasingly prescribed for children since 1992. Researchers led by Dr. Jerry L. Rushton, a pediatrician and Robert WoodJohnson C...

Evidence Shows Drug-Psychotherapy Combo Effective For Chronic Depression

...yresults cannot be extrapolated to any other antidepressant used in combination with psychotherapy or other lessstructured forms of psychotherapy, Keller said. The psychotherapy used in the study is a structured, intensive program,developed by James P. McCullough of Virginia Commonwealth Un...

Music, relaxation can complement pain medicine

..., type ofsurgery, chronic pain, first surgery, and antidepressant use. The groups werealso similar in demographic and surgical factors, and in medication intake attime of treatment. These were all things that could have confounded the outcome but didnot, she said. Good and her research staff met with the...

Depression-treating drugs lead record-setting pharmacy benefit cost rise -- Total increase lower when pharmacy benefit actively managed

...in 1997. Toan attributed the growing popularity of antidepressant drugs, to "greaterpublic awareness and acceptance of depression as a disease and the availabilityof easier to dose, less toxic, better tolerated medications like selectiveserotonin reuptake inhibitors and selective norephinephrine reuptakeinhibitors....

Keep an eye on the weather if you take herbal antidepressants

People using the herb St John's wort as an antidepressant should take extra careif they go out in the sunshine to cheer themselves up. A combination of thepopular herbal remedy and bright light can lead to cataracts, researchers told ameeting in Washington DC last week. Hypericin, the active ingredi...

The effects of St. John's Wort (Hypericum perforatum)

...depression. Furthermore the mechanism by whichthis antidepressant effect is exerted has been shown to be similar to ... studies have shown that hypericum is an effective antidepressant forthe treatment of mild to moderate depression. Studies conducted in patients withmild to moderate ...

Antidepressant drug alleviates hot flashes in men undergoing prostate cancer treatment

ROCHESTER, MINN. -- Venlafaxine, an antidepressant drug, helps reduce theincidence of hot flashes in men undergoing androgen-deprivation therapy forprostate cancer, according to a recent Mayo Clinic report published in theJournal of Urology. The researchers found that 10 out of 16 men (63 percent...

Genetic engineering changes the behavioral and hormonal response to stress

...t, that is a widely used test in thedevelopment of antidepressant drugs. In addition, the susceptibility tostress-induced elevations in plasma corticosterone levels was associated withthe adrenoceptor mutations. The altered adrenoceptor expression was also foundto modify the brain dopamine and serotonin content and...

A key to depression

...ovides an explanation for the 'therapeutic lag' in antidepressant therapy," Jacobs told the meeting. Jacobs thinks serotonin could also help to treat other neurological diseases, such as Alzheimer's. But he cautions that it probably won't be of use to healthy people: "Their level of neurogenesis might already be o...

Scientists identify new pathway of antidepressant action

...tion. They tested the three SSRI's and a tricyclic antidepressant known as imipramine. The scientists found that ea...urges of allopregnanolone synthesis. The tricyclic antidepressant showed no such effect. Mellon says the research strengthens the likelihood that the enzymes that sy...

New study led by U. Pitt researcher shows mirtazapine cuts risk of depression relapse by more than 50 percent

...sion versus those who continued treatment with the antidepressant Remeron (mirtazapine). Additional data presented at the meeting demonstrated that mirtazapine, a dual-action antidepressant, relieves depression more quickly than some commonly prescribed selective serotonin reuptake inhibitor (SSRI) antidepressant...

1 2 3 4 5 6

(Date:4/18/2014)... scientists could lead to potential new treatments for breaking ... , Fibrosis, or scarring, is a hallmark of ... lungs can lead to serious organ damage and, in ... options centers on findings made by Swati Bhattacharyya, PhD, ... that a specific protein plays in promoting fibrosis. ...
(Date:4/17/2014)... popular vaccine brands for children may not be the ... cost factors when choosing vaccines, driving the market toward ... a new study by University of Illinois researchers. , ... by numerous factors," says Sheldon H. Jacobson, a co-author ... and of mathematics at the U. of I. "In ...
(Date:4/17/2014)... NY In a review published in the April ... president of The Feinstein Institute for Medical Research, says ... medical community,s approach to treating sepsis, which ... Americans. , Sepsis occurs when molecules released into the ... throughout the body. Inflammation is necessary for maintaining good ...
(Date:4/17/2014)... many as 10 million older Americans suffer from depression, ... , However, new research a project that followed ... six years found that Internet use among the ... than 30 percent. , "That,s a very strong effect," ... telecommunication, information studies and media who led the project. ...
(Date:4/17/2014)... 17, 2014 EcoHealth Alliance, a nonprofit organization that ... a comprehensive review today examining the current state of ... review calls for improved global surveillance strategies to combat ... outbreak of Ebola in West Africa that has claimed ... Guinea and Liberia. According to the World Health ...
Breaking Medicine News(10 mins):Health News:New clues on tissue scarring in scleroderma 2Health News:Study recalculates costs of combination vaccines 2Health News:Feinstein Institute researcher publishes new perspective on sepsis 2Health News:Internet use can help ward off depression among elderly 2Health News:Re-emergence of Ebola focuses need for global surveillance strategies 2Health News:Re-emergence of Ebola focuses need for global surveillance strategies 3
Other Tags
pandoraswettergrasslandsleftieshygieniccapacitiesmusculaturemirnasawaresummitkyotoesabrachytherapyinversetemporarilysue