Tag: "babies" at medical news

Could a mandated food additive aimed at better fetal development be a risk for seniors?

... fortify with folic acid to better assure that all babies are born healthy, the government should also encourage deficiency screening of the elderly to ascertain that such laudable efforts do not come at the expense of inadvertent harm to others....

U.S. News & World Report ranks The Children's Hospital of Philadelphia the top pediatric center

...ically advanced, multidisciplinary care for unborn babies with genetic or anatomical abnormalities. Center physicians are considered pioneers in the innovative field of fetal surgery....

Thymus transplant might save babies born without immune systems

...red the procedure to transplant thymus tissue into babies with DiGeorge Syndrome to enable their bodies to l...geons to expose the heart. Markert asks parents of babies undergoing heart surgery for permission to use any discarded thymus tissue to help a child with DiGe...

Scientists develop greater accuracy in recording babys heart rates in the womb

...gy organisation, to study the heart rate of unborn babies in minute detail. The technique, reported in this months British Journal of Obstetrics and Gynaecology, will allow doctors to monitor the health of babies' hearts and obtain the full fetal ECG (fECG), particularly during high risk pregnancies, such ...

Babbling key to evaluating speech development in babies with hearing loss

... a result, within the first two years of life more babies and toddlers are receiving hearing aids or cochlear implants, which are surgically implanted electronic devices that process sound and directly stimulate the auditory nerve. "More than 40 states now implement universal infant hearing screenings, so t...

Clinical study of Penn State Hershey technology begins in South Africa

...se the chest wall stabilizer, a device that allows babies with respiratory distress to breathe easier. "Although the device could be an option for babies who need help with breathing in technologically-advanced hospitals like those in the United States, ...

Scientists shed new light on speed of infant learning

...postulate that object knowledge could be something babies are born with. But new research by a team of psych...e unobscured trajectory. The team also found that babies who were six months of age had already grasped the fundamentals of object concepts, suggesting that ...

Dental procedure may reduce risk of premature birth

...ording to new study findings. Nearly 12 percent of babies in this country are born preterm (before 37 completed weeks of pregnancy), which increases their risk of death and lasting disabilities, such as mental retardation, cerebral palsy, lung and gastrointestinal problems, and vision and hearing loss. The ...

UCSD researchers identify chromosome location for 2nd form of Joubert syndrome

...normal breathing pattern called hypernea, in which babies pant; abnormal eye and tongue movements; and mild or moderate retardation. The type of Joubert syndrome now traced to chromosome 11 also includes eye or kidney problems, in addition to the classical symptoms associated with the disorder. "The hunt f...

Nevirapine sustains advantage over AZT during breastfeeding period

... percent risk reduction for the NVP group when the babies were 6 to 8 weeks of age. The cost savings of usin...ime of greatest risk of HIV transmission. Although babies in both groups continued to acquire HIV throughout the study, they did so at approximately the same ...

Further evidence for effectiveness of nevirapine in reducing mother-to-child HIV-1 transmission

...ntrapartum/neonatal zidovudine regimen when 87% of babies in the trial had reached age 14-16 weeks. The same...mothers up to six weeks after delivery and for all babies up to 18 months of age. From late 1997 to early 1999, HIV-1 infected pregnant women in Kampala, Ugan...

Low and high birthweight increase risk of cerebral palsy

... cerebral palsy; at the other end of the spectrum, babies born in the top 3% range for birthweight have up t...esearch has indicated that low birthweight in term babies is associated with increased risk of cerebral palsy. Stephen Jarvis from the University of Newcastl...

'Genetic switch' proves two mechanisms exist by which immune system cells differentiate

...ly erodes. This is one reason why older people and babies are frequently sickened by or die from diseases that cause little harm to those from their teenage years to midlife. Likewise, certain diseases can kill off T-cells, making the body vulnerable to a host of infectious diseases, almost as if their bod...

Deadly decision: Where should baby sleep?

...ffocation that is as much as 40 times greater than babies who sleep in standard cribs, a Saint Louis Univers...trics. "The odds of death go up dramatically among babies who use adult beds," says James Kemp, M.D., one of the researchers and an associate professor of ped...

Antiretroviral therapy after birth decreases mother-to-child HIV transmission

Antiretroviral therapy given to babies after birth offers protection against HIV infectio...researchers also report that giving these drugs to babies after birth is easier to administer when compared to giving antiretrovirals to mothers during pregna...

Antiretrovirals reduce mother-to-child HIV-1 transmission when started after childbirth

...T highlight how antiretroviral therapy targeted at babies soon after childbirth (because their mothers' HIV ...ssessed whether nevirapine and zidovudine given to babies only reduced HIV-1 transmission more than nevirapine alone. Over 1100 babies of Malawian women with...

Brain may 'hard-wire' sexuality before birth

...y offer physicians a tool for gender assignment of babies born with ambiguous genitalia. "Our findings may help answer an important question -- why do we feel male or female?" said Dr. Eric Vilain, assistant professor of human genetics and urology at the David Geffen School of Medicine at UCLA and a pediatr...

Resurgent rickets - Call for vitamin D supplementation for pregnant women and children

...ithout vitamin D supplementation, particularly for babies whose mothers are vitamin D deficient; reduced opportunities for production of the vitamin in the skin because of female modesty and fear of skin cancer; and the high prevalence of rickets in immigrant groups in more temperate regions. Nick Bishop c...

UK childhood blindness more common than previously thought

... diversity and greater survival of low-birthweight babies is contributing to a higher proportion of children...enced by the increased survival of low-birthweight babies and the susceptibility of children from ethnic minorities to certain ocular conditions. Jugnoo Rahi ...

Scientists identify novel enzyme with key role in leukemia protein's normal function

...per. Mixed lineage leukemia strikes fewer than 100 babies every year in the United States, but it is typically fatal in 60 percent. It is caused by damage to the MLL gene, which then makes a mutant MLL protein. James Hsieh, MD, PhD, and Emily Cheng, PhD, are the paper's first and second authors, respectivel...

1 2 3 4 5 6 7 8 9 10

(Date:4/17/2014)... 17, 2014) Two recent papers by a ... colleagues may help scientists develop treatments or vaccines ... Japanese encephalitis and other disease-causing flaviviruses. , Jeffrey ... molecular genetics at the School of Medicine and ... Medical Institute, and colleagues recently published articles in ...
(Date:4/17/2014)... Le Bonheur Children,s Hospital Pediatrician-in-Chief Jon McCullers, MD, ... the April issue of Nature Reviews Microbiology ... Dr. McCullers, a world-renowned infectious disease specialist, ... the University of Tennessee Health Science Center, analyzed ... 1918, 1957 and 1968 pandemics, as well as ...
(Date:4/17/2014)... April 17, 2014U.S. military personnel who served in ... concussive traumatic brain injury (TBI) were compared to ... other medical reasons. Differences in measures of overall ... months after injury are reported in an article ... journal from Mary Ann Liebert, Inc., publishers. The ...
(Date:4/17/2014)... million older Americans suffer from depression, often brought on ... research a project that followed the lives of ... found that Internet use among the elderly can reduce ... , "That,s a very strong effect," said Shelia Cotten, ... and media who led the project. "And it all ...
(Date:4/17/2014)... about one in five infants in the United States ... first several months after birth. Research into probiotic use ... the April 1, 2014 issue of the British ... study, "Probiotics and Infant Colic," concluding that the use ... colic did not reduce crying or fussing in ...
Breaking Medicine News(10 mins):Health News:CU researchers discover target for treating dengue fever 2Health News:Long-term effects of battle-related 'blast plus impact' concussive TBI in US military 2Health News:Internet use can help ward off depression among elderly 2Health News:New study says probiotic use for infant colic is not effective in reducing symptoms 2
Other Tags
greatlyrumorsintegrityoctopussecretsbacteriumanthraxpotentialscreendefencesevadeshieldlovedincapacitatedwishespacemaker