Tag: "before" at medical news

Study shows promise in identifying kidney failure

...ur decades to diagnose kidney failure early enough before it progresses into a chronic or deadly condition,"...markers that could help us make the diagnosis well before it is too late. We identified a candidate protein for the early and rapid diagnosis of acute renal i...

Exercise-induced shortness of breath not always caused by asthma

...the patient has normal lung function when measured before exercise, it is probably not asthma. "If a patient is not responding to the simplest measure, such as use of a bronchodilator inhaler, and there are no other asthmatic symptoms, the exercise-induced shortness of breath, also known as dyspnea, require...

UNC study: Most N.C. family practitioners engage in unrecognized community service

...nts reported strong interests in community service before medical school and residency, yet few reported any relevant training during medical education," Goldstein said. "More than 85 percent of faculty and community practice family physicians reported participating in volunteer service in the previous year...

The trust game: Measuring social interaction

...hanges until a decision about trust occurred even before the latest interaction was completed. "This stud...ged so that his or her intention to trust occurred before the completion of the previous round. The technique holds promise for understanding diseases such a...

It's winning, not losing, that triggers violence at sports events

...he match and the day after. Attendance peaked just before midnight on the day of the match. On days when no match had been played, the average number of assault cases fell to 21. When the researchers took into account whether the match was home or away, and won or lost, they found that the result had a sign...

Late developers may run higher risk of infection than sexually mature younger teens

...s say that early maturers, who start their periods before the age of 12, have high oestrogen levels and develop physically faster than late developers. This could help cut their infection risk. They conclude: "We suggest that a sexually active 18 year old with late [periods] may be more susceptible to mul...

HIV testing should be routine part of primary health care for sexually active

...re missing opportunities to diagnose HIV infection before individuals develop AIDS, when we can offer counseling about secondary prevention and risky behaviors, begin antiretroviral therapy and help prevent opportunistic infections." Current recommendations for testing in high-prevalence areas (where HIV in...

Brain activity prior to treatment flags vulnerability to antidepressant side effects

...underwent a one-week, single-blind placebo lead-in before being randomized to four weeks of double-blind tre...udy. Changes in prefrontal brain function observed before start of medication signaled a greater number of adverse effects during antidepressant treatment....

Unexpected benefit seen in treating HER-2 breast cancer with new preoperative drug combo

...r Center. When combined with chemotherapy and used before surgery in early stage breast cancer the drug prov...ll as less risk of heart damage than has been seen before with Herceptin treatment, "the jury is still out on the long-term safety and outcome. As in all such...

Consumers with disabilities empowered by American Disabilities Act

... disabilities that was passed within the ten years before their interviews. Approximately that same number could identify it as the ADA. Those that did name the ADA were more likely to perceive positive changes and improvements over those who could not name it or were unaware of a law being passed. Yet, ...

Protecting children from industrial chemicals in the environment

...gation to prove that their chemicals are non-toxic before marketing them. While the US Environmental Protection Agency (EPA) has entered into an agreement with the American Chemistry Council, the chemical manufacturer's trade association, to provide basic toxicity screening tests for the high-production ch...

Advertising by academic medical centers may risk eroding public trust, says study

...ace the financial interests of the medical centers before the interests of the patients, the authors conclude. "We found it interesting that similar advertising practices by pharmaceutical companies have been criticized for creating demand for services and failing to present balanced information, but no one...

Indiana University researchers closer to helping hearing-impaired using stem cells

...ing marrow-derived stem cells with these molecules before transplantation might greatly enhance the possibility that the process would result in development of specific sensory neurons."...

Bullying among sixth graders a daily occurrence, UCLA study finds

...parents to talk with their children about bullying before it ever happens, and to pay attention to changes in their children's behavior. Students who get bullied often have headaches, colds and other physical illnesses, as well as psychological problems. "If your child doesn't want to go to school and is c...

Hepatotoxicity and statins

...ently calls for monitoring of liver biochemistries before and during usage. "It is now evident that elevated aminotransferases are insensitive to detect underlying hepatic steatosis and patients with advanced fibrosis and cirrhosis may have entirely normal aminotransferases," he reports. After considering ...

Novel therapy tested in mice could chase away cat allergies

...er research and clinical testing would be required before it might be used in humans. He also is interested in applying this approach to develop a preventive treatment for serious food allergies. NIAID is a component of the National Institutes of Health, an agency of the U.S. Department of Health and Human ...

Optical technique identifies vulnerable plaques in cardiac patients

...onary artery disease every year, a quarter of them before or soon after arriving at the hospital," says Ik-K...study. "The ability to identify dangerous plaques before they rupture and produce a heart attack or sudden cardiac death will be crucial to innovative preven...

Researchers search for first sign of congestive heart failure

...illion Americans. "What we are saying is that long before the pumping chamber of the heart becomes enlarged ...se changes, we may be able to stop the progression before the heart becomes dysfunctional." Dr. Kapuku recently received a four-year Scientific Development Gr...

Hopkins begins human trials with donor adult stem cells to repair muscle damaged from heart attack

...the trial. All patients will have been stabilized before acceptance to the trial, and have undergone cardiac catheterization and ultrasound echocardiography to check that their main coronary vessels are clear of blockages that may precipitate another heart attack. Eligible candidates must be able to safely...

New estimates for the causes of child deaths worldwide

...0 times more likely than a western European to die before his or her fifth birthday."...

1 2 3 4 5 6 7 8 9 10

(Date:6/19/2013)... Ultimate Medical Academy (UMA) participated in the 30th ... News Channel 8. Since its inaugural televising in 1984, ... All Children's Hospital in St. Petersburg, Fla. , The ... marked the second year UMA volunteered for All Children's. ... during the Telethon, which raised a substantial $4.2 million ...
(Date:6/19/2013)... Imprivata ®, a leading global provider ... Imprivata OneSign ® leads the single sign-on (SSO) category ... & Services report . CIOs and other healthcare executives ... performance of its products and the quality of its ... is integral to their long-term healthcare IT strategy. ...
(Date:6/19/2013)... HI (PRWEB) June 19, 2013 ... company is dedicated to being an effective and cost ... reception needs. They have partnered up with Tom Barefoot’s ... and discounts on most of Hawaii’s activities. , They ... how clients can get the lowest prices on their ...
(Date:6/19/2013)... 19, 2013 The producers of Viewpoints ... Phoenix, Arizona. The city is located in the center ... has shed its frontier image and become an affordable city ... the fifth-largest city in the United States with a workforce ... offers residents a low cost-of-living, friendly business environment and more ...
(Date:6/19/2013)... MAYWOOD, Il. A Loyola University Chicago Niehoff School ... grant to study whether Vitamin D can improve mood ... study also will examine whether vitamin D supplementation can ... their diabetes. The grant is from the National Institute ... , Principal investigator Sue M. Penckofer, PhD, RN and ...
Breaking Medicine News(10 mins):Health News:Ultimate Medical Academy Rallies in Support of All Children's Hospital 2Health News:Ultimate Medical Academy Rallies in Support of All Children's Hospital 3Health News:Imprivata Tops Single Sign-On Category in KLAS 2013 Mid-Term Performance Review 2Health News:Imprivata Tops Single Sign-On Category in KLAS 2013 Mid-Term Performance Review 3Health News:Maui'd Forever Pleased to Offer Price Guarantee on Hawaii Activities 2Health News:Viewpoints TV Announces June Air Dates for Phoenix, AZ 2Health News:Loyola receives $1.5 million grant to study vitamin D for diabetes and depression 2
Other Tags
capillarymaterialisemisshapentacticsoupamchitkapassivelawnsstaraffirmsmelodyunbornregretbeverageassurefao