Tag: "benefit" at medical news

Hospital Stays Longer Than Three Days For 'Simple' Heart Attacks May Not Be Cost Effective

...irst attempts to quantify what is thereal clinical benefit of a day in the hospital." The research team studied detailed records of more than 40,000 patientswho had participated in the GUSTO-I clinical trial between 1990 and 1993. Theprimary purpose of that trial was to compare the effectiveness ...

Discarded Treatment For Heart Attacks May Yet Prove To Be A Life-Saver

...ere irregular heartbeats,showed either significant benefit or a trend towards a benefit in patients whoreceived GIK. "The sample size is very small and perhaps the findings are infl...

Maxim Phase II Clinical Trial Highlights Substantial Increase In Leukemia-FreeSurvival For Acute Myelogenous Leukemia Patients

...lar agents we have not seen evidence ofsignificant benefit to the patients. The Maxamine results suggest the potentialfor a meaningful advancement in the care of AML patients." Patients treated in their second or subsequent remission ("CR2+") historicallyhave a poor prognosis with about 5% achieving long-...

"Super" Aspirin Does Super Job In Fighting Heart Attacks

...), or undergoing balloon angioplasty --may instead benefit from these platelet blockers. Other authors are Robert M. Califf, M.D.; Robert A. Harrington, M.D.; James E.Tcheng, M.D.; and Vic Hasselblad, Ph.D. of Duke; Dave P. Miller, M.S.; David J.Moliterno, M.D.; A. Michael Lincoff, M.D.; and Eric J. Topol, ...

American Heart Association Comment: Results Of Cardiac Insufficiency Bisoprolol Study II (CIBIS-II)

...s. The trial was stopped prematurely becauseof a benefit in favor of bisoprolol. During an average follow-up period of 1.3years, 11.8 percent of patients on bisoprolol died, compared with 17.3 percentof those who received placebo....

Fred Hutchinson Cancer Research Center And Targeted Genetics Corp. Publish Data On Adoptive Immunotherapy For HIV

...odes -- provides hope that thisform of therapy may benefit HIV-1 infected persons. The patients treated onthis study were receiving one to two antiretroviral drugs. Future studies areplanned for patients on antiviral cocktails with the hope that the cells willlast longer in such persons. In addition, cyto...

Ultrasound Measurement Of Neck Arteries May Help Doctors Identify Older Adults At Increased Risk For Heart Attack And Stroke

...ed to "help identify asymptomaticpersons who would benefit from aggressive prevention measures," he said. Such aggressive measures might include lowering high blood pressure orhigh cholesterol levels further than in other patients, more strict control ofdiabetes, and perhaps medical or surgical inter...

Soy May Decrease Cancer Risks, Wake Forest Researcher Says

...uncertain." Cline said not all women would benefit equally from consuming estrogensin the soy, becaus...s ability to respond to the estrogen. "The benefit of soy phytoestrogens is clearer for dietary exposuresearly in life and for premenopausal women," Cl...

Managed-Care Incentives Should Be Disclosed, Physician Says

...rs could help educate thepublic about how patients benefit from these incentives and reinforce theircommitment to act as patient advocates," he says. "If there are safeguards inplace to make it less likely that incentives cause problems, disclosure couldhelp develop partnerships between doctors and patients ...

Nurse Practitioners Reducing Costs, Expanding Care

...rnative to seeing a doctor, nursepractitioners can benefit patients in other ways as well. "For the most part, a physician's income -- particularly that of a generalpractitioner -- will fluctuate depending on the number of patients seen,"Wilkerson says. "So it's in his or her best interest to treat as ma...

Study Finds Clot-Busting Drug Ineffective Or Even Harmful If Not Used Soon After A Stroke

...er that 3-hour window, this study shows tPA has no benefit inimproving stroke recovery," said Clark. "In addition, there's a 7 percent riskthe stroke will get worse if the drug is used after three hours, including a 3percent chance of early death." This study confirms that beyond three hours, tPAcan cause da...

Program Developed At UF Enables Computer To "Emote" In Speech

...ise for thespeech-disabled. "It's of great benefit because people do not want to hear the monotonoustype of dialogue that is usually associated with computer synthesized speech,"he said. "I think it's quite fascinating." Dankel said computer-generated voices are likely to become much morecomm...

Duke Doctors Can Now Cure Most Babies Born With Fatal Immune Disease

...es patients vulnerable to infection is alsoof some benefit during treatment, Buckley said. Because they have no T-cells,SCID patients do not require chemotherapy to destroy them, as is the case withcancer patients. "Patients with SCID have no immune systems to reject the transplants.Our approach avoi...

Women Who Have Invasive Cervical Cancer Benefit From Addition Of Chemotherapy To Radiation Treatment

...ith locally advanced cervical cancer were shown to benefit from takingchemotherapeutic drugs while receiving radiation therapy. The study was led byscientists at The University of Texas M.D. Anderson Cancer Center. "Overall, the patients who received chemotherapy were more likely tosurvive their dise...

Improved Medications Can Nip Allergy Season In The Bud

...ines. People with allergy-triggeredasthma can also benefit from these medications along with prescribed cortisonesprays, which contain steroids that reduce inflammation. Though both Dorit and Jesse had undergone extensive allergy testing in yearspast, Dr. Mohsenifar does not suggest this as a first line of d...

First Clinical Trial In Bay Area To Test Effect Of HIV Vaccine; SF Department Of Public Health And UCSF Recruiting Study Volunteers

...owards apreventive AIDS vaccine." "We will greatly benefit from the expertise these two research groupsbring to this important clinical trial," said Don Francis, M.D., D.Sc., president ofVaxGen. "As a Bay Area company, we are pleased to be working with the people ofSan Francisco to test this vaccine." Both t...

Help On The Way For Victims Of Paralysis

..." He says ultimately people with disabilities will benefit from nerve cuffimplantations. Hoffer says a primary goal is to restore the voluntary use ofparalyzed limbs, but other functions might also be restored. "People with brainor spinal cord injuries not only have paralysis, they also have difficulty witho...

Space Research May Accelerate Development Of Flu-Fighting Drug

...ial Space Center --encouraging private industry to benefit from space technology. Dr. Ming Luo, aprofessor of the Center for Macromolecular Crystallography, and an internationalteam of crystallographers, developed the "molecular map" of the flu virus usingspace-grown protein crystals. Influenza prot...

More Evidence Of Possible Adverse Effects From New Hormone Use In Women With Heart Disease

...en who take HRT also tend to do other things that benefit their health and reduce their risk of heart disease, such as exercising regularly, following a sensible diet and avoiding smoking, Alexander said, so a "natural selection bias" is introduced into such studies which can distort the results. HERS, o...

Study Of Women And Hearing Reveals Need For Routine Hearing Tests

...p develop effective communication strategies would benefit thegrowing population of older women. To combat the adverse emotional feelings experienced by many individuals withhearing loss and to enable them to remain engaged in activities that requireeffective communication, Garstecki has developed a rehabili...

1 2 3 4 5 6 7 8 9 10

(Date:12/20/2014)... 20, 2014 Parker & Sons, Inc. ... years of experience in contractor services announces reaching a ... for the homeowners of Arizona. Parker and Sons is ... contractor technicians that make customer service the number one ... Arizona and started with one service vehicle and has ...
(Date:12/19/2014)... (PRWEB) December 19, 2014 Sub Zero Ice ... sponsor a blood drive Sunday the 28th from 2pm-6pm at ... & Sawyer Road in Sarasota, FL. , Inquiries regarding time ... you for participating in the donating process, Sub Zero Ice ... flash frozen, custom ice cream. , About Sub Zero Ice ...
(Date:12/19/2014)... 2014 Eufaula, Oklahoma, located just 9 ... the state’s largest lake with more than 600 miles ... to a little more than 3,000 residents, hosted its ... the 6th of December. , Featuring Santa, Christmas lights ... Eufaula on Main Street. Narconon Arrowhead’s parade float ...
(Date:12/19/2014)... warns parents that buying an older car for their teens may ... drivers killed in the United States between 2008 and 2012 were ... lacked important safety features that are available on newer cars, the ... were in cars at least six years old, 34 percent were ... cars 11 to 15 years old, and 17 percent were in ...
(Date:12/19/2014)... 2014 (HealthDay News) -- Dense bunches of bacteria called biofilms ... new study finds. The researchers said these biofilms ... The presence of these biofilms may represent an increased ... to predict a person,s risk for the disease, the researchers ... these biofilms may coat the mucus layer of cells lining ...
Breaking Medicine News(10 mins):Health News:Parker & Sons Announces Reaching A Milestone By Providing 40 Years Of Dedicated Contractor Services For Homeowners Of Arizona 2Health News:Parker & Sons Announces Reaching A Milestone By Providing 40 Years Of Dedicated Contractor Services For Homeowners Of Arizona 3Health News:Shark Tank’s Sub Zero Ice Cream Sponsors Blood Drive 2Health News:Narconon Arrowhead Debuts Float at Checotah and Eufaula Christmas Parades 2Health News:Narconon Arrowhead Debuts Float at Checotah and Eufaula Christmas Parades 3Health News:Older Cars a Bad Choice for Younger Drivers 2Health News:Could Bacteria Play a Role in Colon Cancer? 2
Other Tags
interfacebalancelonglinecasualtiesadversarycommerciallymirrorcletarcevashuntsalertssilenceamplifymetalsthinksvolunteersfully