Tag: "build" at medical news

U of T researchers describe 'Joe Canadian' tongue

... data from more tongue cancer patients in order to build a database for surgeons who perform partial tongue resection surgeries. "The survival rate in tongue cancer is 70 to 80 per cent," says Bressmann. "Therefore, surgeons need to do a very good job because people will often live with their reconstructio...

NIH awards USC $8.7 million to study tobacco use in China

... greater than ever." The new center's studies will build upon earlier research conducted by the USC Transdisciplinary Tobacco Use Research Center. Co-principal investigators of PR TTURC are Jennifer Unger, associate professor of preventive medicine at USC, and Gary Swan, director of the Center for Health S...

Bone density returns when teens stop using Depo Provera, Group Health study finds

...d to avoid unintended pregnancies with the need to build strong bones." Scholes' study, which appears in the February 2005 issue of Archives of Pediatric and Adolescent Medicine , is the first to show that teen-aged Depo-Provera users' bone loss appears to be reversed once young women stop taking the con...

Rice's CNST awards Smalley/Curl funds for innovation

...iss out on future opportunities, CNST continues to build its endowment for the Smalley/Curl Fund and to search for new ideas that have a high probability of impacting the local economy."...

Children's Hospital Oakland opens new $5.6 million infectious disease lab

...Center for Research Resources (NCRR) at the NIH to build the CIVD. Dr. Lucas was the principal investigator on this grant. The remaining funds were secured through individual donations and large financial gifts from the philanthropic community. CHORI's operating budget in 2005 is $48 million, which is gen...

States find alternate routes to health coverage

...es continued to reach out to the private-sector to build partnerships, with many seeking new opportunities for collaboration. Many of these strategies seek to bolster employer-sponsored insurance by helping small employers offer coverage or enabling low-income workers to purchase insurance. States also ta...

University of Washington joins new Autism Treatment Network to provide better medical services

...rds of treatment for people who have autism and to build a national autism database, said Geraldine Dawson, director of the UW's Autism Center. The database will collect information on the range of medical conditions from which people with autism suffer and those treatments that have been tested and have ...

HIV vaccine trial breaks ground for future research

... the scientific community a foundation on which to build future trials. The multi-centered trial, conducted in the United States and the Netherlands and completed in 2003, is described in two papers by the rgp120 HIV Vaccine Study Group, and Peter B. Gilbert and colleagues, which address the vaccine effica...

New way to block pox shows promise in lab study

...ill lose their potency," he says. The new findings build on earlier work by the researchers in which they determined that smallpox growth factor (SPGF), a protein produced by the smallpox virus, attaches to a cell membrane receptor called erb-B1. This interaction primes the cell to become a factory for pro...

Dartmouth awarded $21.8 million NSF grant

...rstand the brain mechanisms of learning as well as build collaborations to implement learning techniques am...rant ever made to Dartmouth College. "We want to build bridges between the researchers who study brain activity involved in learning and the teachers who n...

Disaster funding needs radical reform

... after each disaster. This would allow agencies to build reserve funds, to invest in training, and to act more quickly and save more lives. The system for tracking donations and spending should also be improved, and "disaster proofing" should be taken seriously in all development planning. Short term think...

University of Manchester makes made-to-measure skin and bones a reality using inkjet printers

... CT scans, but with this technology we are able to build a fragment which will fit exactly. We can place ce...able to seed the cells into the construction as we build it, which means 'sticking' isn't a problem," says Professor Derby. Professor Derby believes the pote...

Brown and NIH create joint neuroscience graduate program

...g in the neurosciences," DeLong said. "The NIH can build on that foundation with a vast range of laboratory experience at the cutting edge of neuroscience. These students will get training that is second to none." Students are eligible to apply now for fall 2005 admission to the Brown neuroscience graduate...

Grapefruit juice and medication can be a dangerous mix

...esources to grapefruit juice, the medication could build up to dangerous levels, causing a breakdown of the body's muscles and even kidney failure. This is likely what happened to the patient discussed in the article, Karch says. To prevent such problems, Karch repeats what doctors and nurses tell their pa...

Northwestern Memorial chosen to be featured in first-ever mini-med school TV airing on PBS

...recruited to NMH from the Cleveland Clinic to help build the Northwestern Cardiovascular Institute and launch NMH into a new era of heart care. "Participating in this show was an amazing opportunity not only for NMH, but for me individually. I'm not only a physician and researcher, but also a professor ...

Macular degeneration patients benefit from self-management training

...s exercises specially designed for AMD patients to build confidence in their physical abilities. Even after six months, the data indicate that this relatively simple intervention may protect against depression that often occurs in AMD patients, and improves the AMD patients' function, self-efficacy and emo...

Entrepreneurism Center at UC San Diego funds commercialization of lung, shock, other devices

...3800 meters. The purpose of this new project is to build a full prototype with both O2 and CO2 analyzers and the appropriate electronic circuitry. West believes the handheld, self-contained alveolar gas meter has potential commercial value because it would permit non-invasive testing, notably in the hospit...

Doctors must consider potentially inappropriate medications when treating elderly

...opriate for the elderly. "With age, drugs tend to build up in the body, and the distribution and eliminati...ike diazepam (Valium) and other anti-anxiety drugs build up fast." Also, doctors may not know all the prescriptions, let alone over the counter, drugs that ...

Workers with carpal tunnel find relief with night-time splinting

... that you will feel the benefits." Werner hopes to build on the findings from this study by conducting a larger study to determine the cost-effectiveness of splinting and its long-term benefits for patients. In addition to Werner, the study was co-authored by Alfred Franzblau, M.D., associate professor in ...

Children's Hospital at Vanderbilt ranked 8th in nation by 'Child' magazine

... a driving force behind thefund-raising efforts to build the new hospital, "This ranking is proofto the community that we've made the right choice for our children."...

1 2 3 4 5 6 7 8 9 10

(Date:5/18/2013)... May 18, 2013 Spectrum Surgical ... on May 17-22 in Austin, TX where thousands ... educational and networking opportunities. , Spectrum Surgical/STERIS ... flexible scope repair capabilities and certified pre-owned ... educational information on proper instrument care of flexible ...
(Date:5/18/2013)... Irvine CA (PRWEB) May 18, 2013 The ... Scrum classes are scrum framework, scrum roles, scrum meetings, scrum ... development units (8 PDUs) for attending them. , These trainings ... directors. It is also ideal for those who will be ... industry or those who want to explore Agile and Scrum, ...
(Date:5/18/2013)... Wine World Accessories, a renowned online ... an attractive 25% discount on Franmara Dynamo Electric ... now purchase this electric corkscrew opener for $44.95 via ... The online store ensures delivery of their items within ... , A spokesperson from the online store elaborates ...
(Date:5/18/2013)... CA (PRWEB) May 18, 2013 ... latest update to consumers about transvaginal mesh ... federal court Resource4thePeople reports that plaintiffs have ... to court documents. , The rulings came ... District Court in the Southern District of ...
(Date:5/18/2013)... 2013 Medical device company, FlexLeg, LLC, last ... anticipated mobility aid with its namesake, the FlexLeg. The ... crutch alternative that injured individuals can use to walk ... can remain active and walk during a typical 6-8 week ... system to ensure those who need the device most are ...
Breaking Medicine News(10 mins):Health News:Spectrum Surgical Attends Society of Gastroenterology Nurses and Associates' (SGNA) 40th Annual Conference in Austin, TX 2Health News:Affordable Scrum Trainings In Irvine by Conscires Agile Practices 2Health News:Affordable Scrum Trainings In Irvine by Conscires Agile Practices 3Health News:Now Save 25% on Franmara Dynamo Electric Wine Bottle Opener at Wine World Accessories 2Health News:2013 Alleged Transvaginal Mesh Complications Lawsuits Update: Resource4thePeople Reports Defendants Ordered to Provide Testimony, Documents 2Health News:2013 Alleged Transvaginal Mesh Complications Lawsuits Update: Resource4thePeople Reports Defendants Ordered to Provide Testimony, Documents 3Health News:2013 Alleged Transvaginal Mesh Complications Lawsuits Update: Resource4thePeople Reports Defendants Ordered to Provide Testimony, Documents 4Health News:FlexLeg Begins Offering New Mobility Aid 2
Other Tags
naturetoldentrepreneursrepellentsfiringmixesriboswitchespeekscryingnighttimechronicinfantsmaasiowacabonathan