Tag: "cells" at medical news

USC Researcher Lights Up The Immune System To Help Heart Transplant Recipients

...otentially allows us to suppress only those immune cells responsible for rejecting a donated organ," he...od from patients, sorting out blood rich in immune cells called T-lymphocytes, or T-cells, that play an important role in mounting a defense against fore...

Hopkins Researchers Develop New Therapy For Autoimmune Disorders Such As Rheumatoid Arthritis And Lupus

...ansplants are unnecessary. "Stem cells,the marrow cells that reconstitute the immune system, are resistant...nations and exposure to organismswhich teachimmune cells to recognize and attack foreign bodies." In people with autoimmune disorders, the immune system...

Dynavax Demonstrates Ability Of Immunostimulatory DNA Sequences To Inhibit Symptoms Of Allergic Asthma In Animal Model

...nt to the proliferation andsurvival of white blood cells involved in inflammation (eosinophils). They alsoexamined the effect of ISS-DNA on subsequent airway hyperreactivity in responseto an allergic challenge. The researchers' results showed that administration ofISS-DNA inhibited both airway hyperrespons...

Study Offers Hope For Immune Reconstitution After HIV Infection

...rtially reconstitute an HIV-infectedindividual's T cells after his or her viral load has been driven down b...the technique developed to track newly produced T cells couldprove to be a valuable research tool for monitoring immune reconstitution inHIV-infected people...

Thymus May Hold Clue To Rebuilding Immune System After HIV

...T-cells produced by the thymus. The number ofthese cells in the blood indicates the level at which the thym...fically inhibits the thymus either by infectingthe cells within the organ, or affecting the ability of the thymus to produceT-cells by an unknown mechanism,"...

Discovery May Boost Effectiveness Of Chemotherapy

...rotein pumped three common anti-cancerdrugs out of cells rapidly, before the drugs could get to the nucleus of thecancer cells and destroy them. "This is only the fourth molecular drug resistance pump of anti-cancerdrug...

Fred Hutchinson Cancer Research Center And Targeted Genetics Corp. Publish Data On Adoptive Immunotherapy For HIV

...f the antiviral activity." Cytotoxic, or killer, T cells (CTLs) that function to eliminate virally infectedor malignant cells are part of the normal, healthy immune system. For thoseinfected with HIV these CTLs are present, b...

Patent Received On Drug Delivery System

...ystem includes incorporating drugs into macrophage cells and deliveringthe cells intravenously to patients. Macrophage cells, which are localized incertain parts of the body, have a...

UK Allied Health Professor Receives Patent On Using Lithium With AIDS Drugs

...ncing properties andcould possibly protect certain cells from toxic therapies. Gallicchio proposesthat com...ffect could bethat the lithium could cause certain cells with the AIDS virus to die. "It will remain to be determined whether these new dru...

Vanderbilt Cancer Center Discovery May Help Overcome Resistance To Anti-Breast Cancer Drug

...with tamoxifen -- the resistance that breast tumor cells commonly develop tothis "anti-estrogen" drug. Writ... of the femalehormone estrogen. Some breast cancer cells are sensitive to estrogen, whichbinds to estrogen receptors in these cells and stimulates them to pr...

Hunter College Biologist Marie Filbin Identifies Mechanism That Blocks All Inhibitors Of Nerve Regeneration; Breakthrough Reported In Neuron Magazine

...found that applying MAG antibodies to the affected cells had the reverse effect and actually fostered nerve regeneration. Marie T. Filbin, a resident of Manhattan's Upper West Side, has been on thefaculty of Hunter College's Department of Biological Sciences since 1990. Nameda CUNY Distinguished Professor...

Statistician Keeps Health Researchers Ahead Of The Curve

...IDS Cohort Study to determine how the level of CD4 cells -- acritical measure of the strength of the body's...will enable physicians to predict how quicklythese cells will decline. This information will help doctors and patients planan appropriate course of treatment...

Immunex's TRAIL Molecule Shows Potential As Anti-Tumor Agent

...the study, groups of mice were injected with tumor cells from a human breastcancer, or either of two differ... directly andselectively induce apoptosis of tumor cells and may have potential in thetreatment of a wide variety of cancers," said David Lynch, Ph.D., senio...

Promising Bone Cancer Therapy Advances To Next Level

... result of many primary cancers,arising when tumor cells spread, or metastasize, through the bloodstream to thebones. It strikes 60 to 80 percent of all prostate and breast cancer patients,causing severe pain in more than 75 percent of patients. Conventional treatments include strong sedatives, wh...

Duke Doctors Can Now Cure Most Babies Born With Fatal Immune Disease

...roximately 20 times the amount of bone marrow stem cells than other centersdeliver, a technique that speeds their ability to "grow" an immune system fromtheir donor cells. What has lagged behind treatment, Buckley says, is the rapid and earlydiagnosis needed to screen children with SCID before th...

Ablatherm: An Ultrasound Device For Prostate Cancer Therapy

...d a partial response to treatment: residual cancer cells weredetected in 9 patients although their mean PSA..., while theother 3 patients had no residual cancer cells but a slightly elevated PSA level. Finally, treatment was considered to have failed in the remaini...

Interleukin-2 Boosts Cancer Vaccine Effectiveness In Mice

...in-2, a growth factor that stimulatesimmune system cells to divide and multiply, with a cancer vaccine made fromspecialized white blood cells called dendritic cells, which alert the body'simmune system to the presence of cancer. "The addition...

Insulin Resistance And Obesity Avoided In Genetically Modified Mice, As Reported In Science

...sk for the disease. Diabetesoccurs when the body's cells are unable to absorb enough blood sugar, orglucose...ong-term complications. To store and use glucose, cells need assistance from the hormone insulin, whichcontrols a complex series of steps to remove glucose ...

First Clinical Trial In Bay Area To Test Effect Of HIV Vaccine; SF Department Of Public Health And UCSF Recruiting Study Volunteers

...signed to stimulate the bodyto produce white blood cells that specifically recognize the gp120 protein andthen produce antibodies to gp120. Vaccine researchers hope that these antibodieswill be able to recognize and bind to the gp120 protein on the surface of realHIV when it infects the body, thereby preve...

Scientists Link Body Weight Regulation And Immune System Control

...mans andwas shown to mediate communication among T cells and other white blood cellsthat form part of the immune system. Pinpointing the mahogany gene and showing its relationship to attractin isimportant, says Barsh, "because it suggests an additional molecular pathway thatcould affect immune function." ...

1 2 3 4 5 6 7 8 9 10

(Date:7/25/2014)... (PRWEB) July 25, 2014 AttorneyOne.com, a recognized ... latest information from the FDA on Ibuprofen and Oxcarbazepine ... that one lot of Ibuprofen and one lot of Oxcarbazepine ... due to mislabeled packaging. Oxcarbazepine is used for the treatment ... , The reason for the recall is that Lot ...
(Date:7/25/2014)... July 25, 2014 Parker Waichman LLP, ... of consumers comments on a recent tobacco lawsuit in ... smoker $23.6 billion in punitive damages. Cynthia Robinson brought ... cigarettes. The case is Cynthia Robinson v. R.J. Reynolds ... Florida First Circuit Court, Escambia County, Florida; Case Number ...
(Date:7/25/2014)... Drexel University College of Medicine is pleased ... been appointed vice dean for education, effective October 1, 2014. ... Medical College, where she is currently chair of the Department ... of medicine. , As a member of the senior ... major role in many aspects of the development of the ...
(Date:7/25/2014)... vulnerable neurons and reduce motor deficits in a ... University School of Medicine have shown. , The ... Parkinson,s Disease . , The findings demonstrate that ... at sufficient levels and have beneficial effects when ... Previous studies of XPro1595 in animals tested more ...
(Date:7/25/2014)... 25, 2014 The new report ... Feed, Pharmaceuticals and Others), by Type (Amylases, Cellulases, ... Geography - Global Trends & Forecasts to 2019", ... of the global Carbohydrase market with analysis of ... is segmented and values are forecasted on the ...
Breaking Medicine News(10 mins):Health News:Ibuprofen and Oxcarbazepine Tablets Recalled: AttorneyOne Monitors and Keep Consumers Informed 2Health News:A Florida Jury Awards Widow More Than $23 Billion in Punitive Damages in a Lawsuit Brought Against Tobacco Maker, R.J. Reynolds, Parker Waichman LLP Comments 2Health News:A Florida Jury Awards Widow More Than $23 Billion in Punitive Damages in a Lawsuit Brought Against Tobacco Maker, R.J. Reynolds, Parker Waichman LLP Comments 3Health News:Valerie D. Weber, MD, Appointed Vice Dean for Education at Drexel University College of Medicine 2Health News:Valerie D. Weber, MD, Appointed Vice Dean for Education at Drexel University College of Medicine 3Health News:Anti-inflammatory drug can prevent neuron loss in Parkinson's model 2Health News:Carbohydrase Market worth $3,717.7 Million by 2019 - Report by MarketsandMarkets 2Health News:Carbohydrase Market worth $3,717.7 Million by 2019 - Report by MarketsandMarkets 3Health News:Carbohydrase Market worth $3,717.7 Million by 2019 - Report by MarketsandMarkets 4
Other Tags
historyevolutionarysalamanderrewritesbrewsphysicistsmillipedescavechemoembolisationpfilegatomariannepersonalizedheaviertvsenlargement