Tag: "differently" at medical news

Mayo Clinic study shows melatonin helps alleviate violent sleep disorder symptoms

... can be mistaken for sleep apnea, which is treated differently than RBD. Patients also may have other sleep disorders that can be diagnosed and treated. Furthermore, Dr. Boeve points out that it is critical for patients to be evaluated and treated appropriately, because RBD is associated with certain neurologic ...

Abdominal fat, a contributor to heart disease risk, is related to alcohol drinking pattern

...he type of alcohol consumed appeared to contribute differently to the accumulation of abdominal fat, findings showed. Wine drinkers showed the lowest abdominal height, while liquor drinkers had the highest. Beer as an alcohol source wasn't associated with central adiposity. In addition, current drinkers, those...

False memories, failing recall are not an inevitable consequence of aging, research suggests

...ence. False memories occur when we remember events differently from the way they occurred, or in the most dramatic cases, when we remember events that never happened. False memories often result when we mistakenly merge elements of various past experiences or when imagination is used to fill holes in a sketchy r...

Green teas cancer-fighting allure becomes more potent

...nmental Health Science Center. "Green tea may work differently than we thought to exert its anti-cancer activity." Gasiewicz and Palermo showed that the chemicals shut down the AH receptor in cancerous mouse cells, and early results indicate the same is true in human cells as well. In the laboratory the AH-in...

How should medical care that emphasizes human relationships be taught to future doctors?

...ered care means that we have to think a little bit differently about how we approach patients, how we approach health care colleagues, and how we approach our students. Quality health care and quality medical education are all about quality relations with one another," said Stephen Leapman, M.D., executive assoc...

Increased heart mortality rates linked to lower state subsidies of uninsured in New Jersey

...p said. "This suggests that patients were treated differently (after HCRA was instituted), and that difference may have included other quality-of-care changes that we were unable to measure."...

Study points to methods for safe drug dispensing via computer

...will examine how BCMA is used differently in acute care wards, nursing homes, and intensive care units. Roger Chapman, another research specialist in Ohio State's Institute for Ergonomics, is going to investigate how nurses' use ...

Disparity between rich and poor for hip, knee replacement

... although there may be. But people may communicate differently with their physicians depending on their gender and socio-economic status. This, in turn, may very well affect whether or not they receive certain treatment options like hip and knee replacement surgery." Hawker says she and her co-researchers are ne...

Protecting babies from RSV could reduce the chances of wheeze and asthma during childhood

...ew of our understanding of immunology, is just how differently the immune system deals with RSV infection at different ages, and the long-term consequences that neonatal infection can have on immune responses and pathology later in life." Primary RSV infection in newborn mice followed the same viral kinetics as ...

Studies offer new treatment option to prevent kidney rejection

... immunosuppressant that controls the immune system differently than its more widely used counterpart and, according to Inman's preliminary findings from a study in rats, may do so without harming the kidney. "The kidneys treated with cyclosporine fared much worse that those treated with rapamycin," Inman said, ...

Cocaine-exposed children subject to stereotyping

...same videotapes of healthy infants were rated very differently when given the label of "born without any known problems" versus "born without any known problems other than the infant's mother had used cocaine during pregnancy." When videotaped infants were labeled cocaine-exposed, they were rated as less smart,...

UW-Madison leads $26 million study on aging

..., we age in different ways. But exactly why we age differently remains much of a mystery. A new study led by the University of Wisconsin-Madison, however, plans to make the reasons more clear. With a $26 million, six-year grant from the National Institute on Aging (NIA), the project will bring together 40 resear...

Researchers find promising new target for anxiety-reducing drugs

... selectively inhibit PKC epsilon and modulate GABA differently from the existing imperfect drugs such as benzodiazepines with their sedative and addictive side effects. "We don't know that yet, but this work gives us new hope," the scientist said. In an accompanying commentary, Dr. Joshua A. Gordon of the Cent...

Chemists show proteins behave differently inside cells than they do in water solutions

...ntally for the first time that proteins can behave differently inside cells than when taken out of those cells and studied in test tubes. "For 40 years, we thought we could learn most everything about proteins by studying them in water, but this work shows we are missing important observations by looking at them...

Ecstasy may be drug of choice for those trying to cope with lonelienss, study finds

...y, cope with the distressing effects of loneliness differently than non-drug users. Ecstasy users scored highest on all the coping strategies except for the reflection/acceptance and the religion/faith factors, the two factors where non-drug users scored the highest, and the other drug using group had the lowest...

Sites chosen for public-private Osteoarthritis Initiative

...ated by the fact that the disease manifests itself differently in each person. When complete, the OAI should provide an unparalleled state-of-the-art database showing both the natural progression of the disease and information on biomarkers, x rays and outcome measures. This database should allow inves...

Wake Forest researchers find brain region 'exquisitely' sensitive to alcohol

...n the thalamus possess an ion channel that behaves differently depending on the amount of alcohol that has been d...aves during stage II sleep as in people and reacts differently depending on the amount of alcohol. "Despite widespread interest in the influence of alcohol on sle...

Study: Cognitive therapy at least as effective as drugs in treating severe depression

...ion, 16 months. "We looked at depression somewhat differently than prior studies," said Hollon, professor of psychology at Vanderbilt. "The question that has most often been asked in studies is, What gets people better faster? We asked, What will keep depression away over the long term?" The study by DeRubei...

Dealing with death

...dgement; the same situation can be perceived quite differently by different patients. Dr. Cohens research examines not only the physical, psychological and social aspect of well being, but the spiritual and existential dimensions as well. Dr. Cohen received the 2001 Dorothy J. Lamont Scientist Award for her wo...

Impaired sodium excretion after stress contributes to hypertension in blacks

...tresses of the day are affecting these individuals differently in that they are affecting their long-term blood pressure control system, Dr. Harshfield said, noting his previous work at Charles R. Drew University in California which showed that the blood pressure of blacks doesnt drop, even when sleeping, as muc...

1 2 3 4 5 6 7 8

(Date:8/22/2014)... (PRWEB) August 22, 2014 A new, online ... connection. The summit is no-cost and open to everyone. ... kept secrets, practical tips and advice on how to stop ... or manage weight. Mindful eating is not a diet. ... stay motivated instead of an "eat this, don't eat that" ...
(Date:8/22/2014)... who need surgery for facial pain caused by trigeminal ... used, reports a study in the September issue of ... Congress of Neurological Surgeons . The journal is ... part of Wolters Kluwer Health . , Percutaneous ... lower cost than other types of surgical treatments for ...
(Date:8/22/2014)... Ticket Down is a reliable source for ... Albuquerque and Rapid City. For fans looking to speak with ... allows just that. Caputo was born and raised in Hicksville, ... knit family who began to see spirits when she was ... had a chance to do what most people wished they ...
(Date:8/22/2014)... 2014 Pirate Jonny's Caribbean ... in providing new recipe cards, fun t-shirts, and caps ... Hailing from Clearwater, Florida, Pirate Jonny, aka, Jonathan Toner, ... with two to three recipes featuring different flavors of ... on the website. The recipe cards will feature ...
(Date:8/22/2014)... According to the new research ... Global Trends & Forecast to 2019" defines and ... forecast of the market value. The isocyanate material ... 2019, at a significant CAGR from 2014 to ... 44 figures spread through 286 pages and in-depth ...
Breaking Medicine News(10 mins):Health News:20 Top Experts Discuss How to Unravel the Food-Mood Connection 2Health News:More common procedures for painful facial tics carry high costs, reports study in Neurosurgery 2Health News:Theresa Caputo Tickets in Kalamazoo at Wings Stadium, Saenger Theatre in New Orleans, Kiva Auditorium in Albuquerque and Rapid City at Don Barnett Arena Now Available 2Health News:Pirate Jonny's Caribbean BBQ Rubs, Seasonings & Sauces Get New Look by Hoisting New Recipe Card Creations and New Clothing Apparel for its Logos 2Health News:Isocyanate Market An Industry Growing Steadily Projected to Grow $38,729 Million by 2019 - Report by MarketsandMarkets 2Health News:Isocyanate Market An Industry Growing Steadily Projected to Grow $38,729 Million by 2019 - Report by MarketsandMarkets 3Health News:Isocyanate Market An Industry Growing Steadily Projected to Grow $38,729 Million by 2019 - Report by MarketsandMarkets 4
Other Tags
circuitrythinkingmapsdeficitdyingdesertcardiometabolicdipregrowparametersmanagesscriptshandfulavertperversitydrills