Tag: "discovery" at medical news

Wilmington chemist wins national award for drug development

...on said from his Wilmington, Del., office. "Both discovery processes were incredibly frustrating. Some molecules we made weren't soluble enough, others not potent enough, broke down too rapidly or couldn't get blood levels high enough to really attack HIV," he said. Each project team tried and discarded ab...

Science, engineering and technology newstips

...YSICISTS HOT ON TRAIL OF SUPERCONDUCTORS January's discovery of high-temperature superconductivity in magnesium diboride, a common laboratory compound, has set scientists scrambling to understand the phenomenon, said physicist Warren Pickett of the University of California, Davis. Using a computer model, Picke...

Increased prostate cancer diagnoses tied to access to screening

... widespread use of PSA testing has resulted in the discovery of some non life-threatening tumors and latent prostate cancer (that is, an incidental lesion that, if left untreated, should not affect the duration or quality of a mans life). Adds Liu: "The benefits of PSA testing and the potential for over-diagno...

Baylor team discovers reason for heart transplant failure

... problem," Towbin said. Towbin and Bowles said the discovery suggests that all heart transplant patients should be biopsied routinely with PCR evaluation performed each time. They believe these results could lead to new therapies and preventative measures, such as an anti-viral vaccine for use prior to transpl...

Microbes and the dust they ride in on pose potential health risks

... dust plumes. NASA-funded researchers who made the discovery believe the stowaway microbes might pose a health risk to people in the western Atlantic region. Dale Griffin, Virginia Garrison, and Eugene Shinn of the U.S. Geological Survey (USGS) and Jay Herman of NASAs Goddard Space Flight Center outline their ...

8,000 pharmaceutical scientists to explore breakthrough research, technology

...e therapy, pharmacogenomics and its impact on drug discovery and marketing, clinical trials in children, role of drug transporters in the brain, and emerging pharmaceutics strategies for more efficient drug candidate identification." Topics to be presented include: Genomics: Impact on Drug Discovery and Marke...

Crystallographers meet in Los Angeles

...he 3-D structures of complex biomolecules) and the discovery of new pharmaceutical drugs Session including a new report on the three-dimensional structure of a prion protein, which may help explain the molecular basis for mad cow disease A talk on the chemical composition of the paint color Naples Yellow, spon...

Scientists image material that could improve MRI technologies

...high-temperature superconductors a relatively new discovery may be a better material, with the bonus of requiring less cooling, thus reducing costs," said Halperin. To advance its potential application in future technologies, the researchers first need to understand the physical properties of these materials...

Virginia Tech students discoveries can help prevent water-borne diseases

...on through the treatment plant." Another important discovery by the Virginia Tech student is that bubbles can cause a dilemma for treatment plant operators at the end of the process. "When bubbles form after water has gone through filtration, water quality tests may wrongly identify the bubbles as dirt particl...

Four researchers awarded Dutch Nobel Prize

... a modest role in these problems. One interesting discovery made by Professor Boomsma is that the genetic infl...iple end groups. Besides being responsible for the discovery of the process of large-scale synthesis of a specific dendrimer, his group used dendrimers as nanoco...

Researchers find better way to predict childhood brain tumor outcomes

...ously unrecognized kinds of cancer and provide new discovery tools to explore and ultimately to interfere with the basic machinery of cancer. Some of the studies are so preliminary that biological meaning is still largely conjecture; others serve up good possibilities for imminent clinical testing. This study...

Research shows way to boost morphine's pain-killing benefits

...sing dosages. If confirmed in further studies, the discovery could lead directly to more effective relief using...Many drugs are able to trigger endocytosis, so the discovery suggests a practical way to boost the duration of morphines pain-killing benefits without having to ...

Gene discovery shows heart failure cause, suggests treatments and screening potential

...tory findings and also opened a window to how this discovery could prevent or slow the advancement of the disease. "One patient received a transplant, and so we were able to examine the structure of the diseased heart. We found irregularities and fragmentation at the interface between muscle cells that is con...

Mayo Clinic researchers identify gene for inherited kidney and liver disease in young children

...ociated with renal failure and neonatal death. The discovery may improve prospects for gene testing and diagnosis of this life-threatening disease. The results of the Mayo Clinic study are published in the March issue of Nature Genetics. Autosomal recessive polycystic kidney disease (ARPKD) is one of the most ...

Researchers identify for the first time proteins vital to maintaining nervous system architecture

...cells or between nerve cells and muscle cells. The discovery of the maintenance mechanism was a surprise to the research team. Dr. Hobert, a developmental neurobiologist, and his colleagues had not set out to find these maintenance proteins. The team had been studying when and where certain genes would act dur...

Honing the tools to identify clues to surviving cancer

...ork may ultimately lead tostudies resulting in the discovery of drugs that activate proteins or blockreceptor sites for biologic pathways," he notes. Dr McDonald also heads themedical informatics program of the Indiana Genomics Initiative at IU. Thefundamental research goal of INGEN is to establish the relat...

Duke researchers identify the mechanisms by which drug combinations kill fungal infections

... undergoing organ and bone marrow transplants. The discovery of how the immune-suppressing drugs enhance the action of antifungal drugs could lead to the development of new drugs designed to treat fungal infections such as systemic yeast infections and often-deadly cryptococcal infections. Led by Dr. Joseph He...

Yale researcher receives $1.4 million grant to study the hypocretin cells involved in narcolepsy

...e of this neurotransmitter within two years of the discovery of hypocretin benefited from a host of basic science discoveries. These discoveries were related to the organization and cellular physiology of the hypocretin system and were made prior to the finding that hypocretin loss leads to narcolepsy," said V...

NICHD scientists develop vaccine against deadly hospital-acquired infection

...sylvania State University, first made the critical discovery that S. aureus has capsular polysaccharides-complex sugar molecules-in its outer covering, or capsule. Dr. Karakawa, working with scientists at the NICHD; Willie Van of the U.S. Food and Drug Administration; Jean-Michel Fournier of the Institute Pas...

Annals of Internal Medicine, tip sheet, February 19, 2002

...ne the best schedule for surveying the colon after discovery and treatment of colorectal cancer. Blood Supply Safety Varies Between Developed and Developing Countries An article reviewing the current status of blood safety in several countries finds that in developed countries, viral transmission from cont...

1 2 3 4 5 6 7 8 9 10

(Date:11/24/2014)... (PRWEB) November 24, 2014 Global ... 6.19 billion by 2020, according to a new ... rates of cardiac arrhythmias clubbed with growing global ... this market. Though still in the budding stage, ... rise in usage rates in the recent times, ...
(Date:11/24/2014)... 2014 Residents of retirement communities in ... year’s SENIORS GOT TALENT, an annual online talent competition ... players to classic crooners, to seniors partying on a ... are indeed living young. , “SENIORS GOT TALENT, while ... cash prize, has always been about highlighting the vibrancy ...
(Date:11/24/2014)... York (PRWEB) November 24, 2014 The ... by the Family and Children's Association to ... as soap, shampoo, mouthwash and other such items.The Association's ... who are home bound, living in nursing homes, assisted ... to greatly enhance the well being of seniors throughout ...
(Date:11/24/2014)... SafeHandles™ announced that they will be featured ... Jr, airing via Discovery Channel. Dates and show times ... non-invasive, replaceable, and affordable germ protective device. This segment ... and adhesives to promote hand hygiene in high traffic ... SafeHandles is the desire to make a positive impact ...
(Date:11/24/2014)... Pittsburgh, PA (PRWEB) November 24, 2014 ... as he was trying to cross the street in ... "The driver never saw him. I came up with ... easily visible at night." , He developed the Safety ... night or in low-lighting conditions. The device ensures that ...
Breaking Medicine News(10 mins):Health News:Electrophysiology Devices Market Worth Forecasted To Reach $6.19 Billion By 2020: Grand View Research, Inc. 2Health News:Electrophysiology Devices Market Worth Forecasted To Reach $6.19 Billion By 2020: Grand View Research, Inc. 3Health News:Electrophysiology Devices Market Worth Forecasted To Reach $6.19 Billion By 2020: Grand View Research, Inc. 4Health News:Nursing Homes & Assisted Living Retirement Communities Enter Seniors Guide's Seniors Got Talent 2Health News:Nursing Homes & Assisted Living Retirement Communities Enter Seniors Guide's Seniors Got Talent 3Health News:The Holiday Inn Westbury - Long Island gives back to the local Long Island community, and also goes beyond borders to assist those in need during the 2014 Holiday Season 2Health News:The Holiday Inn Westbury - Long Island gives back to the local Long Island community, and also goes beyond borders to assist those in need during the 2014 Holiday Season 3Health News:New Episode of Innovations TV Series to Feature SafeHandles™ 2
Other Tags
interactivemucolipidosisregularlyace2elbowtenniscushingpituitaryusgsagigrapefruitreleasewishespacemakerafghanistanreturning