Tag: "disease" at medical news

Wine Drinkers Consume Heart-Smart Diets

...healthy diet has on the etiology of ischemic heart disease compared to the intake of wine, remains to beanswered in a prospectively designed study....

Duke Doctors Can Now Cure Most Babies Born With Fatal Immune Disease

...s without ahospital stay. "This once-fatal disease should be seen as a pediatric emergency thatrequires immediate diagnosis and treatment because now there is a proven therapythat can save a child's life," Buckley said in an interview. Buckley's program has yielded the highest reported succes...

Ablatherm: An Ultrasound Device For Prostate Cancer Therapy

...ed with a mean follow-up period of 340days. Local disease control in 80% of cases The treatment was considered a success in 28 of the 50 patients, i.e. thosewho had a complete response (the control biopsies showed no residual cancercells, and the mean PSA level fell significantly then stabilized ). 12 p...

Komen Foundation Announces Application Deadline For 1999 National Grants

...is to eradicatebreast cancer as a life-threatening disease by advancing research, education,screening, and treatment. The Komen Foundation is one of the nation's largestprivate providers of funds for breast cancer research, awarding more than $11million in grants in 1998....

Interleukin-2 Boosts Cancer Vaccine Effectiveness In Mice

...advanced lung and skin tumors showed noevidence of disease after treatment," Mulé said. "Others exper... mice receiving the same vaccine withIL-2 remained disease free. Eighty percent of mice with well-established sarcomas showed completeregression of their tumo...

Morning Coffee Boosts Blood Pressure, Stress Hormones All Day

...percent increase in the incidence ofcoronary heart disease While researchers have long known that caffeine can boost stresshormones and blood pressure, Lane said most studies have been conducted in alaboratory setting under tightly controlled circumstances where a single dose ofcaffeine is compared t...

Evidence For A Heart Failure Epidemic Released

...icine. "Often times when people think of a chronic disease epidemic, AIDS or cancermight come to mind. But heart failure must be taken seriously," Dr. McCulloughsays. "Resource planning for the management of chronic heart failure must takeplace by health systems along with local, state and national public he...

New Book (And Web Site) Use 'Currency' Of Aging To Guide And Motivate Healthy Choices

... pulls together more than25,000 studies on health, disease prevention and longevity not only suggestsways for...resent value'of drugs designed not to cure current disease but to prevent it in thedistant future. So we did some quick calculations and decided that takinghis...

National Pilot Study To Test Whether Soy Can Reduce Prostate Cancer Risk

...ring properties that help reduce the risk of heart disease and othercardiovascular diseases. The study will involve 160 men, half African-American, between the agesof 55 and 70 who have high levels of prostate-specific antigen on the PSA test,but who have normal prostate biopsies, she said. The trial will me...

Study Highlights Flu Risks For Women With Chronic Illness

...onary disease, diabetes, malignancy, chronic renal disease and HIVinfection. While the vast majority - betwe...atients with diabetes,malignancy and chronic renal disease were comparable with the risks faced bypatients with chronic lung or heart disease. What's more, the...

More Evidence Of Possible Adverse Effects From New Hormone Use In Women With Heart Disease

... use of hormones in women who have previous heart disease and the occurrence of a second cardiac "event," su...women without heart disease, women who have heart disease should probably not start using them," Alexander said. "We also have no reason to suggest women sto...

UB Oral Biologists Find Link Between Gum Disease And Passive Exposure To Tobacco Smoke

...y increased risk of having more severe periodontal disease thanthose who were not exposed, after adjusting for age, gender, race, education,income and diabetes mellitus, important known risk factors of gum disease. The risk of severe attachment loss increased 11/2-2 fold, while the riskof severe gingival gu...

Vinegar Offers Dependable Test For Cervical Cancer

... The testidentified almost twice as many cases of disease as did Pap smears. A simple screening test...ations. Cervical cancer -- a sexually transmitted disease caused by the humanpapilloma virus -- is the leading cause of female cancer deaths in parts ofAfrica...

ENBREL Phase III Data Published In Annals Of Internal Medicine

...entswho have an inadequate response to one or more disease modifying anti-rheumaticdrugs (DMARDs)....

First Evidence Found Of Link Between Gum Disease And High Alcohol Consumption, Low Dietary Antioxidants

...disease. The findings have implications beyond gum disease since bacteria fromgum infections have been shown to play a role in heart disease, lung disease anddiabetes, in addition to destroying gum tissue and bone. Both studies were presented here today (...

NIA Launches National Study To Treat Mild Cognitive Impairment

...itive decline, includingdevelopment of Alzheimer's disease (AD). The upcoming Memory Impairment Study is the...re the bulk of the Federal Government'sAlzheimer's disease research is coordinated. "Now we can use information from Dr. Petersen's study and related studies ...

Study Shows Hormone Replacement Therapy Does Not Elevate Breast Cancer Risk

...ng evidencethat it protects against coronary heart disease and osteoporosis. Long-term ERT, however, may be ...rial cancer. Women with a history of benign breast disease already face a 40-260 percentincrease in breast cancer risk, depending on the type of breast lesion....

Possible Mechanism For Estrogen Memory Enhancement Found

...ing a drug precisely targeted for the treatment of disease whileavoiding unwanted side-effects. USC neurogero...nding that estrogen delays the onset ofAlzheimer's disease in post- menopausal women, calls Thompson's studysignificant. "The inference is that estrogen has ef...

Tobacco Control Is Global Challenge, WHO Director Says

...treating hundreds of thousands of cancer and heart disease patients frombreaking the back of your health systems in the coming decades," she said....

Decline In Vaccination Could Lead To Resurgence Of Rubella

...ella vaccine is not maintained a resurgence of the disease could be seen in the UK. The authors remind readers of the potentially devastating effects of rubella infection and warn pregnant women that an immune' result after a routine antenatal test, does not necessarily preclude any recent or current infect...

1 2 3 4 5 6 7 8 9 10

(Date:5/18/2013)... Family Magazine of Washington DC was awarded the "Best ... Inc. in the category of Summer Camps in DC ... the areas best in the ultimate guide on parenting, kids ... Brenda Hyde, a mother of four and publisher of Family ... vast resources available to them in the DC Metro area. ...
(Date:5/18/2013)... (PRWEB) May 18, 2013 During Better ... loss should consider the legal protections they have, including ... problems arise with their child’s treatment or hearing aid ... Since 1927, the American Speech-Language-Hearing Association has used the ... and to promote treatment, such as cochlear implants, which ...
(Date:5/18/2013)... 18, 2013 Simple changes in a ... snacks and drinking more water can lead to substantial ... a healthier lifestyle overall. Diet Doc understands ... weight loss can be difficult and often requires the ... plans to help patients get over initial weight loss ...
(Date:5/18/2013)... 2013 6Webs.com is the leader in ... reviews and comprehensive comparisons make 6Webs.com the useful resource ... 6Webs.com just recently finished conducting their assessments of the ... Smythe from 6Webs.com reports, "There has been an increase ... ease of use, expandability and mobility. Combine these features ...
(Date:5/18/2013)... Show And Go Training, the culmination of ... systems that is all about is getting results in the ... http://ShowAndGoTrainingReview.com ’s Stan Stevenson, prompting an investigative review. ... “four phase system” designed to make you faster, stronger, fitter ... working out in the gym. The training manual and exercise ...
Breaking Medicine News(10 mins):Health News:Summer Camps in DC "Best of the Best" Awarded to Family Magazine of Washington DC for Excellence by Follow Media Consulting, Inc. 2Health News:Schachter, Hendy & Johnson PSC Lawyer Says Cochlear Implant Victims Should Know Their Legal Rights 2Health News:Schachter, Hendy & Johnson PSC Lawyer Says Cochlear Implant Victims Should Know Their Legal Rights 3Health News:hCGTreatments / Diet Doc hCG Diets & Weight Loss Plans Announce the Best Weight Loss Through New Whole Foods, Healthy Snacks and Prescription Strength hCG Treatments 2Health News:hCGTreatments / Diet Doc hCG Diets & Weight Loss Plans Announce the Best Weight Loss Through New Whole Foods, Healthy Snacks and Prescription Strength hCG Treatments 3Health News:Best Wireless Home Security System Companies Released by 6Webs.com 2Health News:Show And Go Training: Review Examining Eric Cressy's Workout Program Revealed 2
Other Tags
sarawakmalaysianweevilnicetrendupwardpredisposingemphasiscouricmovieadvisestraymitigatesolicitousnessgastroenteritisgatorade