Tag: "exposes" at medical news

Wide use leads to push to test safety of four herbs

...n thepopularity of a relatively untested substance exposes large numbers of people. No data indicating a known problem is required for a nomination. Before making a final decision to test the substances, NTP is requestingpublic comment and any additional scientific information be sent to Dr. ...

Using cocaine during pregnancy may damage developing fetuses, causing lifelong learning disabilities

...dded. "When a pregnant woman uses cocaine she also exposes her fetus to the drug. Studies have shown that these cocaine exposed children have increased occurrence of symptoms similar to those seen with attention deficit hyperactivity disorder increased distractibility, impulsivity and select learning defici...

Lingering cognitive impairment may be linked to coronary bypass surgery

...ly. The procedure -- like many major surgeries -- exposes patients' brains to a variety of abnormal physiological conditions, including inflammation, lack of oxygen, elevated blood sugar, lowered body temperature, showers of microscopic blood clots, and the presence of a lot of amnesia-causing drugs. The N...

PET scans show cigarette smoke affects peripheral organs

... the fact that smoking, which is highly addictive, exposes the whole body to the thousands of compounds in tobacco smoke." Dr. Joanna Fowler, together with Dr. Volkow and others at Brookhaven National Laboratory and the State University of New York at Stony Brook, conducted the study, which will be publishe...

Imaging study reveals effect of smoking on peripheral organs

...e other component of tobacco smoke. "Since smoking exposes the entire body to the tobacco compounds that inhibit MAO B, we believed it had the potential to limit MAO B activity throughout the body," said Fowler, who conducted the current study to investigate this effect. She and her colleagues in the Medical...

Impaired sense of smell increases risk for certain hazards

...less frequently. "In summary, olfactory impairment exposes patients to an increased risk of cooking accidents, ingestion of toxic or spoiled substances, and inability to detect fires and gas leaks," the authors write. "These hazards are potentially life-threatening and collectively pose a significant public...

New imaging technique may help reduce risk of heart attacks, strokes

... minimizing its damage. When a plaque ruptures, it exposes a surface that is thrombogenic, or clot-inducing, Bogdanov explains. So instead of a partial blockage of the artery, a complete blockage can develop. That leads to oxygen deprivation in surrounding tissue and then, depending on location, either heart...

Federal policy has failed to prepare nation for possibility of bioterrorism

...l decline of emergency-room doctors, which further exposes the country to potential disaster in the case of a bioterrorist attack. "If one profession is crucial to control smallpox, it is the emergency-room doctor. If that physician identifies a case two or three days before symptoms become obvious, a timel...

Model predicting colorectal cancer screening suggests higher mortality for virtual colonoscopy

...nt Risk Dr. Faigel warns that virtual colonoscopy exposes normal, healthy people to significant radiation, "A CT scan of the abdomen and pelvis in virtual colonoscopy is a lot of radiation." For this analysis he and his colleagues assumed a single CT scan of the abdomen and pelvis at age 60...

Study suggests Akt3 protein is key to melanoma's resistance to chemotherapy

...cancerous cells to survive and thrive. This study exposes another link in that chain reaction by connecting PTEN to Akt3 in melanomas. Robertson found that PTEN specifically regulates Akt3. Consequently, when PTEN is lost, Akt3 malfunctions and accumulates, allowing melanoma cells to survive. "In addition ...

Study links racial and ethnic gap in youth violence to social factors

...The researchers found that residential segregation exposes black youth to neighborhoods with much higher levels of risk for violence and fewer protective factors than the neighborhoods where other racial and ethnic groups tend to live. "Neighborhoods where more people have professional or managerial jobs are...

Study finds drug eluting stents as effective as vascular brachytherapy in preventing restenosis

...ment, which is a logistically demanding procedure, exposes patients to radiation and is associated with a risk of late restenosis (20 to 40 percent) and late thrombosis. However, whether SES is superior to VB long-term remains an open question, according to Dr. Alameddine. "That will be addressed by ongoing ...

1

(Date:7/25/2014)... (PRWEB) July 25, 2014 AttorneyOne.com, a recognized ... latest information from the FDA on Ibuprofen and Oxcarbazepine ... that one lot of Ibuprofen and one lot of Oxcarbazepine ... due to mislabeled packaging. Oxcarbazepine is used for the treatment ... , The reason for the recall is that Lot ...
(Date:7/25/2014)... July 25, 2014 Parker Waichman LLP, ... of consumers comments on a recent tobacco lawsuit in ... smoker $23.6 billion in punitive damages. Cynthia Robinson brought ... cigarettes. The case is Cynthia Robinson v. R.J. Reynolds ... Florida First Circuit Court, Escambia County, Florida; Case Number ...
(Date:7/25/2014)... Drexel University College of Medicine is pleased ... been appointed vice dean for education, effective October 1, 2014. ... Medical College, where she is currently chair of the Department ... of medicine. , As a member of the senior ... major role in many aspects of the development of the ...
(Date:7/25/2014)... vulnerable neurons and reduce motor deficits in a ... University School of Medicine have shown. , The ... Parkinson,s Disease . , The findings demonstrate that ... at sufficient levels and have beneficial effects when ... Previous studies of XPro1595 in animals tested more ...
(Date:7/25/2014)... 25, 2014 The new report ... Feed, Pharmaceuticals and Others), by Type (Amylases, Cellulases, ... Geography - Global Trends & Forecasts to 2019", ... of the global Carbohydrase market with analysis of ... is segmented and values are forecasted on the ...
Breaking Medicine News(10 mins):Health News:Ibuprofen and Oxcarbazepine Tablets Recalled: AttorneyOne Monitors and Keep Consumers Informed 2Health News:A Florida Jury Awards Widow More Than $23 Billion in Punitive Damages in a Lawsuit Brought Against Tobacco Maker, R.J. Reynolds, Parker Waichman LLP Comments 2Health News:A Florida Jury Awards Widow More Than $23 Billion in Punitive Damages in a Lawsuit Brought Against Tobacco Maker, R.J. Reynolds, Parker Waichman LLP Comments 3Health News:Valerie D. Weber, MD, Appointed Vice Dean for Education at Drexel University College of Medicine 2Health News:Valerie D. Weber, MD, Appointed Vice Dean for Education at Drexel University College of Medicine 3Health News:Anti-inflammatory drug can prevent neuron loss in Parkinson's model 2Health News:Carbohydrase Market worth $3,717.7 Million by 2019 - Report by MarketsandMarkets 2Health News:Carbohydrase Market worth $3,717.7 Million by 2019 - Report by MarketsandMarkets 3Health News:Carbohydrase Market worth $3,717.7 Million by 2019 - Report by MarketsandMarkets 4
Other Tags
historyevolutionarysalamanderrewritesbrewsphysicistsmillipedescavechemoembolisationpfilegatomariannepersonalizedheaviertvsenlargement