Tag: "frank" at medical news

Prying eyes? Researchers can keep it confidential

...courts have affirmed that confidentiality, and the frank and open discussion it creates, can be protected," said Dr. David Bruns, professor of pathology at the University of Virginia Health System and co-author of the paper. "Peer review is what leads to the reports that we all rely on." Confidentiality i...

Undisclosed payments to doctors recruiting trial patients is unethical

...reat patients as equal partners by making full and frank disclosure of payments that trial sponsors make to doctors for recruiting their patients," they conclude....

More than 70 percent of adults with cancer use alternative therapies

...native medicine if they want patients to engage in frank and honest discussion of these choices." Knowledge regarding patient use of alternative medicine also is important, she said, because such use may signal difficulties in coping with the cancer or its treatments and may indicate the need for referral ...

NIH to host symposium: Medicine in the media

...t journalists and scientists. Newsroom Issues: A frank and opendiscussion: what gets in your way ofpresenting the best story, and what can youdo about it? Invited Speakers: Barnett Kramer, MD, MPH National Institutes of Health Robert Park, PhD University of Maryland Melinda Voss Association ofH...

Surgeon General, columnist George F. Will, and McLaughlin Group Take on nations health care issues

...ent Director. "And this year we're excited to hear frank opinions from such prestigious voices on some of the most important and hotly contested issues on the nation's health care agenda." WHAT: Keynote speeches by US Surgeon General Richard H. Carmona, Pulitizer-Prize-winning Columnist George F. Will, ...

Rensselaer awarded NY state funding for alcohol/substance abuse education

...E) orientation program, freshmen get involved in a frank discussion about the dangers of underage and high-risk drinking. Ongoing campus efforts include alcohol awareness training for Resident Assistants, and on-demand educational programs, which are popular with fraternities and sororities. Area high sch...

Graphic images of violence alter children's attitudes toward aggression

...lence shown on television can be countered by more frank and open discussions and displays of what violence really does to the body," says David C. Chang, Ph.D., M.P.H., M.B.A., a coauthor of the study and a graduate fellow in the Department of Health Policy and Management in the Johns Hopkins Bloomberg Sc...

New rights to access, but for most transparency is still as clear as mud

... of All Souls, University of Oxford, is a full and frank examination of transparency and its consequences. According to Alasdair Roberts, there are ways of dealing with the worst effects of governments developing procedures to handle sensitive inquiries. The first is to force officials to commit their pro...

Bevacizumab combined with chemotherapy prolongs survival for some patients with advanced lung cancer

...cizumab therapy. Patients with a prior history of frank hemoptysis (coughing up blood) were also not enrolled on the trial. The most significant adverse event observed in this study was life-threatening or fatal bleeding, primarily from the lungs. This occurred infrequently, but was more common in the ...

1

(Date:4/18/2014)... scientists could lead to potential new treatments for breaking ... , Fibrosis, or scarring, is a hallmark of ... lungs can lead to serious organ damage and, in ... options centers on findings made by Swati Bhattacharyya, PhD, ... that a specific protein plays in promoting fibrosis. ...
(Date:4/17/2014)... popular vaccine brands for children may not be the ... cost factors when choosing vaccines, driving the market toward ... a new study by University of Illinois researchers. , ... by numerous factors," says Sheldon H. Jacobson, a co-author ... and of mathematics at the U. of I. "In ...
(Date:4/17/2014)... NY In a review published in the April ... president of The Feinstein Institute for Medical Research, says ... medical community,s approach to treating sepsis, which ... Americans. , Sepsis occurs when molecules released into the ... throughout the body. Inflammation is necessary for maintaining good ...
(Date:4/17/2014)... many as 10 million older Americans suffer from depression, ... , However, new research a project that followed ... six years found that Internet use among the ... than 30 percent. , "That,s a very strong effect," ... telecommunication, information studies and media who led the project. ...
(Date:4/17/2014)... 17, 2014 EcoHealth Alliance, a nonprofit organization that ... a comprehensive review today examining the current state of ... review calls for improved global surveillance strategies to combat ... outbreak of Ebola in West Africa that has claimed ... Guinea and Liberia. According to the World Health ...
Breaking Medicine News(10 mins):Health News:New clues on tissue scarring in scleroderma 2Health News:Study recalculates costs of combination vaccines 2Health News:Feinstein Institute researcher publishes new perspective on sepsis 2Health News:Internet use can help ward off depression among elderly 2Health News:Re-emergence of Ebola focuses need for global surveillance strategies 2Health News:Re-emergence of Ebola focuses need for global surveillance strategies 3
Other Tags
pandoraswettergrasslandsleftieshygieniccapacitiesmusculaturemirnasawaresummitkyotoesabrachytherapyinversetemporarilysue