Tag: "goes" at medical news

Extended, progressive physical therapy aids stroke survivors mobility

...nal of the American Heart Association. This study goes beyond the commonly held therapy paradigm that stroke patients achieve their most dramatic recovery within the first 30 days after stroke, says lead author Pamela W. Duncan, Ph.D., a physical therapist professor at the University of Florida, Gainesvi...

July/August 2003 Annals of Family Medicine tip sheet

...s office, clinic or other place a person routinely goes to for medical care) is related to lower rates of care in all health care settings. Additionally, the study found that the frequency and location of health care delivery varies substantially with sociodemographic characteristics. The results provide...

Brady announces collaborative grant to develop radiation injury treatment

...of terrorist threats. A large portion of the grant goes to the FSU team for individual financial support, ...ee institution. The remaining portion of the grant goes to U.S. team expenses for travel, supplies, and graduate student stipends. Funding for the CRDF Coo...

SWHR: Report findings affirm health of women hinges on reform of clinical research

... result of the disparity in research, when a woman goes to the doctor for preventive, diagnostic, or therapeutic management of coronary heart disease, her physician must make recommendations on inadequate evidence-based data," said Nanette K. Wenger, M.D., professor of medicine in the division of cardiolo...

Cedars-Sinai Medical tipsheet for July 2003

...edical problems resulting from baby fat that never goes away. Type 2 diabetes is on the increase in overweight and obese children in America. According to Cedars-Sinai Medical Center pediatric endocrinologist David Geller, M.D., Ph.D., "Childhood obesity is the primary reason we are seeing such a huge inc...

Could a mandated food additive aimed at better fetal development be a risk for seniors?

...ncy, if present. The longer their B-12 deficiency goes undetected, the longer their brains and nervous systems will undergo progressive deterioration due to the B-12 deficiency, culminating in a greater risk for the Alzheimer's--like dementia as well as paralysis that can result from B-12 deficiency. ...

Study: Couric's colonoscopy caused cross-country climb in colon cancer checks

...hat has been proven effective at saving lives, but goes unused by millions of Americans at high risk of colon cancer. "This test, which requires healthy people to undergo an invasive, uncomfortable and often embarrassing exam, especially needed a celebrity advocate to reduce the stigma and fear, and there...

Blood test could detect heart attack early

...to, Ontario, which is developing the test. If all goes well in future studies, the test could be available in clinics in three to five years, he says. Researchers have been trying for years to develop better diagnostic tests for heart attacks. In conjunction with an ECG, current tests screen for a varie...

Cancer patients in India cheated of appropriate care

... at the hands of private practitioners. The letter goes on to outline how aspects of appropriate care in developed countries palliative care, counselling, rehabilitation, are rarely offered. While a culture of promoting lucrative but inappropriate treatments prevails, he argues, medical practitioners of ...

Partners seek city's footprint

...gh leakage, and in York, 22% of food is wasted and goes to landfill. "We are not going to start guessing at what Cardiff's figure might be," said Dr Netherwood. "The important thing is that it gives us a vital tool to plan for the future."...

Doctors focus on pupil size for safety of laser vision correction

...n the inside blind is partway down. When the blind goes up, a person looking through the window wouldnt get a clear view unless the previously covered section of the window was washed too. Likewise, MacRae says, surgeons must treat a large part of the cornea so that when the pupil widens, the entire pupil...

Compound developed from mussels may lead to safer, more effective medical implants

... animal or human testing, Messersmith says. If all goes well in future studies, the compound could be used in medical devices in 3 to 5 years, he predicts. Besides implants, the compound could be used as a tooth coating to prevent dental plaque, which is caused by bacterial infection. Ironically, the com...

Economic evaluation shows add-on therapy with Keppra(r) is a cost-effective alternative

...s a patient with chronic epilepsy seizure free, it goes without saying that this is a cost-effective treatment for these patients". Keppra is UCB Pharma's new AED, currently indicated as adjunctive therapy in the treatment of partial onset seizure with or without secondary generalisation in adults with ep...

Morphine-like painkiller appears to be less addictive

... additional animal studies are now planned. If all goes well, an actual drug could be available in five to 10 years, says Polt. Although it will likely be initially administered by injection, developing the drug as an oral pill is now under consideration, he says. The Office of Naval Research and the Nati...

Contact lenses that dispense prescription drugs

...he eyes is that about 95 percent of the medication goes where it's not needed," said Anuj Chauhan, Ph.D., one of the authors of the study. He said that eye drops applied topically mix with tears, which then drain into the nasal cavity and from there, get into the bloodstream and to other organs, where th...

Virtual mass spectrometry laboratory transforms learning experience

...t reads background information about the case then goes to the virtual lab to prepare the sample. In the protein case, for instance, the student must first virtually "digest" the protein to create smaller peptides that are introduced into one of the mass spectrometers for analysis. In the polymer case, a ...

UF researchers report: Immunosuppressant drug prevents late rejection of transplanted kidneys

...ventually stop taking mycophenolate mofetil, which goes by the trade name CellCept, particularly because m...t protecting them from late rejection, which often goes unchecked because by that time they are seeing physicians in the community and they may not be track...

Engineered blood vessels prove durable and clot resistant

...limeters (0.15 inch) in diameter. The vessel then goes through a maturation phase where the separate layers fuse into a homogeneous tissue. After removing the tissue from the steel cylinder, endothelial cells are seeded to the inside to create the inner lining of the blood vessel. Finally, the vessels a...

Researchers link teen sex to early friendships, steady dating

... regardless of how often a teenager goes on dates," Cooksey said. "So frequent dating as opposed to going steady may be more innocuous than going steady when it comes to initiating sexual behavior." The r...

U.S. Food and Drug Administration approves effective new tool to help smokers quit

...monoxide from cigarette smoke. The Commit Lozenge goes to work after you place it in your mouth, releasing nicotine as it dissolves to effectively reduce cravings. The quitter uses fewer and fewer lozenges during the 12-week program until he/she is completely nicotine-free. The 72-count Commit Lozenge...

1 2 3 4 5 6 7 8 9 10

(Date:8/21/2014)... (PRWEB) August 21, 2014 Recently, ... among their patients. Alternative medicine is on the ... to millenials. According to The Fiscal Times, young ... treatments over conventional medicine. , The Fiscal Times ... many millenials are embracing alternative medicine. The article ...
(Date:8/21/2014)... with advanced laryngeal cancer appear to have better ... nonsurgical chemoradiation. , Author: Uchechukwu C. Megwalu, M.D., ... Mount Sinai, New York, and colleagues. , Background: ... are diagnosed each year and squamous cell carcinoma ... Prior to 1991, total surgical removal of the ...
(Date:8/21/2014)... NC -- Researchers have pinpointed the environmental source of ... Southern California for decades. It literally grows on trees. ... of a 13-year-old girl, who spent the summer gathering ... hardest hit by infections of the fungus named ... Cryptococcus , which encompasses a number of species including ...
(Date:8/21/2014)... (HealthDay News) -- Not only is eating better and exercising ... of health-care dollars a year, a new study finds. ... health sciences at Wake Forest Baptist Medical Center in Winston-Salem, ... 2 diabetes patients. Participants ranged in age ... an intensive "lifestyle change program" focused on diet and exercise, ...
(Date:8/21/2014)... The W. Montague Cobb/ NMA ... national voice in the elimination of health disparities, ... the 112th National Medical Association’s (NMA) Annual Convention ... John Ruffin, Ph.D, former Director of the National ... life-long career and innovations have had a significant ...
Breaking Medicine News(10 mins):Health News:Van Uden Center Sees Growth in Alternative Medicine 2Health News:Surgery associated with better survival for patients with advanced laryngeal cancer 2Health News:Fungus deadly to AIDS patients found to grow on trees 2Health News:Getting Healthier a Big Money-Saver for People With Diabetes 2Health News:W. Montague Cobb/NMA Health Institute Honors Three Outstanding Leaders in Health Disparities 2
Other Tags
titantedstinkyhypertensivesdiesellaybeachremovesaceseekpreliminarymitralagesfactquotationsretarded