Tag: "grave" at medical news

Scientists declare global warming and human impacts are combining destructive forces on coral reefs

...sing press conference, "there is clearly cause for grave concern for the future of coral reefs if present climate trends continue." Other scientific panels at the conference emphasized the need to address the many other threats facing coral reefs, among them the destructive fishing practices that are the m...

New definition may make number of heart attack cases soar

...dvertent missed diagnoses of heart attack may have grave consequences, including death," Mehta says. "Using troponin levels allows us to identify more high-risk patients and give them the care they need." Physicians worldwide are becoming aware of the new definition and are incorporating it into their cl...

Devices that emit sounds to track medical status or pinpoint military targets may cause mistakes

...rlying an auditory display, they write, could have grave real-world consequences. They urge researchers to further study perceptual interaction, in order to create more effective sonification techniques -- particularly in situations that demand precision. The researchers also draw on their findings to p...

Drug prescribing by nurses in the UK - Editor of the Lancet urges caution

...which nurse prescribing is being implemented holds grave dangers if the policy set out by Milburn [Minister for Health], Jones [Royal College of Nursing], and others is acted upon - and the first supplementary nurse prescribers are supposed to be qualified by the end of this year - the UK will be embarking...

Could a mandated food additive aimed at better fetal development be a risk for seniors?

...h anemia than with its more subtle but potentially grave complications. Emerging evidence points to B-12 deficiency as an increasingly common reason behind high levels of homocysteine in the blood. While homocysteine, a non-essential amino acid, is normally present in low concentrations in the blood, indi...

Hope for South Africa - at last

...e antiretroviral treatment to tackle the country's grave HIV/AIDS epidemic. Three recent developments are detailed that offer some hope to the nearly 5 million South Africans living with HIV/AIDS: the authority of a South African drug company to develop and produce generic antiretrovirals locally and cheap...

Report cites risks associated with over-the-counter cosmetic contact lenses

...he unregulated sale of contact lenses represents a grave danger to the public." "Many people mistakenly think decorative contact lenses are just like sunglasses. If you're not wearing the lenses to correct refractive errors, you don't need a prescription. This is a dangerous misconception," said one of...

Methamphetamine withdrawal associated with brain changes seen in mood disorders

... General Psychiatry. "Methamphetamine abuse is a grave problem that can lead to serious health conditions including brain damage, memory loss, psychotic-like behavior, heart damage, hepatitis, and HIV transmission," says Dr. Nora D. Volkow, director of the National Institute on Drug Abuse (NIDA), Nationa...

Vietnamese doctor to receive human rights award from NY Academy of Sciences

...may not be receiving any medical attention for his grave ill health." Pagels Award The Academy's first human rights award was given in 1979 to Russian physicist Andrei Sakharov. Renamed in 1988 in honor of former Academy president Heinz R. Pagels, the award has been bestowed on such imminent scientists ...

New research shows stomach (gastric) cancer originates from bone marrow derived stem cells

...bout Stomach (Gastric) Cancer Stomach cancer is a grave problem in much of the world especially Asia, Eastern Europe and parts of Latin America where it's second only to lung cancer as a cause of cancer deaths. In the United States and Western Europe, the incidence of stomach cancer has declined drama...

Disease testing for immigrants: Discrimination disguised as public health policy

...Group on AIDS, which set up the inquiry, expressed grave concerns that the government was seeking ways to "exclude vulnerable individuals on the basis of poor health". The Lancet comments: "Policies that discriminate against visa applicants on the basis of disease risk stigmatising entire sections of soci...

1

(Date:5/22/2013)... 22, 2013 Cedars-Sinai Heart Institute is honoring ... pioneer in modern mitral heart valve repair, Alain ... Corday, MD, International Prize in Heart Research. The ... recognize physicians and scientists conducting groundbreaking research, or ... medicine. , Carpentier is a leading ...
(Date:5/22/2013)... A new study provides neurobiological evidence for ... in people with insomnia, which may have implications ... , "Insomnia has been consistently identified as a ... Franzen, PhD, an assistant professor of psychiatry at ... in the brain circuitry underlying emotion regulation may ...
(Date:5/22/2013)... May 22, 2013 Digital Advertising Agency, ... behalf of its social media management client, Primal ... year's supply of the all-natural organic deodorant. The contest ... of the rapidly-growing start-up deodorant company based in Tampa, ... contest or sweepstakes on a Facebook page is a ...
(Date:5/22/2013)... (PRWEB) May 22, 2013 DiscountFurnaceFilter.com ... quality merchandise ranging from furnace filters, dehumidifiers, fans, ... is excited to add Stadler Form's product line ... summer product line (fans, aroma diffusers and dehumidifiers) ... Form’s Otto Fan is the perfect combination of ...
(Date:5/22/2013)... York, NY and Troy, NY (PRWEB) May 22, ... Medicine at Mount Sinai and Rensselaer Polytechnic Institute ... educational programs, research, and development of new diagnostic ... alliance was commemorated in a signing ceremony on ... initiative to use their expertise—Rensselaer’s in engineering and ...
Breaking Medicine News(10 mins):Health News:Heart valve repair innovator receives Cedars-Sinai Heart Institute's Corday Prize in Heart Research 2Health News:Study shows that insomnia may cause dysfunction in emotional brain circuitry 2Health News:Social Media Management Firm, 21Digital, Launches National Facebook Sweepstakes for Client, Primal Pit Paste 2Health News:DiscountFurnaceFilter.com Now Offers Stadler Form Products - Providing Solutions to All Your Summer Needs 2Health News:Icahn School of Medicine at Mount Sinai and Rensselaer Polytechnic Institute Announce Academic Collaboration 2Health News:Icahn School of Medicine at Mount Sinai and Rensselaer Polytechnic Institute Announce Academic Collaboration 3Health News:Icahn School of Medicine at Mount Sinai and Rensselaer Polytechnic Institute Announce Academic Collaboration 4Health News:Icahn School of Medicine at Mount Sinai and Rensselaer Polytechnic Institute Announce Academic Collaboration 5Health News:Icahn School of Medicine at Mount Sinai and Rensselaer Polytechnic Institute Announce Academic Collaboration 6Health News:Icahn School of Medicine at Mount Sinai and Rensselaer Polytechnic Institute Announce Academic Collaboration 7
Other Tags
deficitmammarymissilesguidedcoloradoinfluencesculturealoneopensdocumentedruinousmethamphtetamineflycheckfacedmetacognition