Tag: "happiness" at medical news

Study finds happiness persists, despite illness

... such adversity assume that it would destroy their happiness when in truth it probably would not." In fact, the... give the first-ever glimpse into the hour-by-hour happiness of seriously ill and healthy people, Ubel notes. It may also help influence policy-level and persona...

Stanford study questions accuracy of ads for body scans

...formation and 7) images. Messages about the happiness and other positive feelings the scans would provide were found in 100 percent of the ads. Fear-evoking messages and other negative pitches were found in 45 percent. The approaches run the gamut from one ad that has people thanking the company, "You'v...

How are we doing? Researchers aim to measure national well being

...nts the measure of GNP with a measure of aggregate happiness is a revolutionary idea." The NIA is part of the National Institutes of Health (NIH) at the U.S. Department of Health and Human Services. In the DRM, participants revive memories of the previous day by writing a short diary. They are told to think...

New research tool aids study of national well-being

...nts the measure of GNP with a measure of aggregate happiness is a revolutionary idea." Using the DRM method, the researchers asked 909 women to recall the previous workday as a sequence of episodes and rate the psychological and social aspects of those activities. Results were compared to experiments ba...

New WHO study asks, 'How happy are you with your lot in life?'

...uality life is closely linked to their feelings of happiness and contentment. However, in other cultures happiness comes out as low as 17th, among the 25 aspects of quality of life that were measured. ...

Wealth does not create individual happiness and it doesn't build a strong country, either

...pment and personal income must not account for the happiness that they are so often linked to. "Scientists are now in the position to assess well-being directly, and therefore should establish a system... to supplement the economic measures," encouraged the report authors, Ed Diener, University of Illinois, an...

The art of happiness...Is volunteering the blueprint for bliss?

...very satisfied with their lives. At the top of the happiness league, and who recorded high levels of volunteering activity, are residents of provincial cities such as Bristol, Chester, Aberdeen and Cardiff and those from Home Counties such as South Cambridge and Rutland. Sevenoaks in Kent recorded the highest ...

Status syndrome: How your social standing directly affects your health and life expectancy

...e higher their position in the hierarchy, the more happiness they enjoyed. This is not a quirk of the British Civil Service. Colleagues in Wisconsin looked at two American studies and found exactly the same thing: the higher the social position the greater the level of happiness. Michael Marmot answers these ...

March/April 2004 Annals of Family Medicine tip sheet

...ulation, Keeley and colleagues found that maternal happiness about a pregnancy and her report of the father's happiness were strong predictors of birth weight and the risk of low birth weight. Specifically, the researche...

How couples manage parenting forecasts later marital quality, study finds

...n infant may have a significant influence on their happiness with each other later." She said that early coparenting behavior "may provide a window into the abilities of partners to manage the many complex conflicts that future family life will bring." While this study looked only at couples with young childre...

St. Paul nurse receives Guardian Angel Award named for UT Southwestern vice president

...ake is a wonderful privilege and a great source of happiness for me," said Mrs. Young, nurse manager of the neonatal intensive care unit (NICU) at St. Paul University Hospital. Mrs. Young received the 2003 Cyndi Bassel Guardian Angel Award last night during ceremonies at the Wyndham Anatole Hotel as part of th...

Children are happy with toys or candy at Halloween

...t. "Poor diet is taking its toll on the health and happiness of America's children," he said....

Doctors have feelings, too

... killed him.'" Almost all participants expressed happiness when they forged a connection with their patients or when patients improved. Participants also expressed for the opportunity to learn and become a physician. With the exception of two students who used humor as a coping mechanism, the majority of pa...

DuPont R&D leader named American Academy of Arts and Sciences Fellow

...y tend to advance the interest, honor, dignity and happiness of a free, independent and virtuous people." The academy has elected among the finest minds and most influential leaders from each generation, including George Washington and Ben Franklin in the 18th century, Daniel Webster and Ralph Waldo Emerson i...

Depressed teens receptive to tobacco advertising more likely to experiment with smoking

....e. ads that insinuate the smoking can be a key to happiness and social success) should incorporate messages about the possible relationship between depression and smoking. According to Audrain, such campaigns should also include messages about how tobacco companies may be exploiting those who are psychologica...

Research links fathers' job stress, other risk factors to parents' knowledge about children's daily experiences

... knowledge, under certain conditions, with marital happiness being animportant factor," Bumpus says. High paternal work demands, in combination with a less happy marriage,were associated with lower levels of parental knowledge. "Happy marriages aremore likely to be communicative marriages, and perh...

ALA/ATS Meeting Explores Gender Differences In Smoking And Lung Transplant Outcomes And Heart Attack Risk From Asthma Medication

... in women. Smoking was associated with feelings of happiness in women,but not in men. These findings suggests possible gender differences in the effect ofnicotine on the central nervous system, possibly because of differentinteractions with hormones, according to the researchers. "The commonly heldbeli...

Program Developed At UF Enables Computer To "Emote" In Speech

...roject five emotionalstates: fear, sadness, anger, happiness and neutrality. The program is easy touse: People type in what they want to say, choose how to express it, then pressa "translate" button on the screen. The program conveys some emotions better than others, Truluck's testsshowed. Of 3...

1

(Date:5/23/2013)... (PRWEB) May 23, 2013 911 Signal USA ... expo will begin on May 22 and run through May ... and information about the company's emergency vehicle lights ... new 2013 Dodge Charger at the expo. , The Charger ... on the market and can be seen by visiting 911 ...
(Date:5/22/2013)... 2013 Most women dread cellulite and ... factors, including estrogen being a factor in the formation ... deposits stored and smashed together which create that dimpling ... take a multi-pronged action," says Kathy Heshelow, founder of ... products like Cellulite Whisperer ® that work to ...
(Date:5/22/2013)... Catalyst Exhibits, Inc., an award-winning global ... its website that allows visitors to view a ... immersive, 360-degree, interactive experience. , The new viewing ... virtually experience the exhibit design Catalyst created for St. ... Users have the ability to interact with the hi-resolution ...
(Date:5/22/2013)... San Francisco, CA (PRWEB) May 22, 2013 ... funerals costing $6,500 or more on average, a funeral concierge ... a funeral, among other benefits. Funeral Financials ... With the average household income in the U.S. ... recession according to Sentier Research, the average funeral costs 12.6% ...
(Date:5/22/2013)... MD (PRWEB) May 22, 2013 On a ... Lisa, spent a few hours watching “The Bourne Legacy” at ... While this may seem like a typical activity to many ... This little stretch of respite from their everyday reality has ... Seals Serving DC | MD | VA. , Life changed ...
Breaking Medicine News(10 mins):Health News:911 Signal USA Attends the 2013 Southwest Police Fleet Expo 2Health News:Get Cellulite Under Control Now with Cellulite Whisperer® Products Introduced by Sublime Beauty® 2Health News:Catalyst Exhibits Debuts 360 Degree Virtual Tour of St. Jude Medical Trade Show Booth 2Health News:Funeral Financials Announces Their Top 3 Reasons to Hire a Funeral Concierge 2Health News:Funeral Financials Announces Their Top 3 Reasons to Hire a Funeral Concierge 3Health News:Military Family Finds Respite with Easter Seals 2Health News:Military Family Finds Respite with Easter Seals 3
Other Tags
reversiblyswitchesmitslittlerappliesspecificityforeveraustraliansrelyfeversovertakemortemscarspresentingpodcastcore