Tag: "healthful" at medical news

Beer found to contain potent antioxidant

...identifies the heretofore-unknown reason for these healthful qualities and suggests, for the first time, their source: the prenylated flavonoids in hops - specifically, the compound xanthohumol, Buhler said. Xanthohumol (zan-tho-HUGH-mol), found exclusively in hops, is six times more effective than antioxidant...

Irradiation, refrigeration can add to beneficial effects of wine grapes

...pes before they are made into wine can magnify the healthful effects of drinking red wine, making a good source...can further stimulate the enzymes that produce the healthful effects, he noted. "By using our treatment, you can increase considerably the resveratrol content of...

Pharmacologist tip sheet: Migraine patches, nicotine therapies, allergy medication interference...

... A glass of grapefruit, orange or apple juice is healthful and tasty, but researchers report that these juices can interfere with a specific protein's ability to take drugs from the intestine into the bloodstream. George Dresser, MD of the University of Western Ontario, and colleagues report in studies with ...

Researchers develop white wine with health benefits similar to red

...hnology in Haifa, Israel. Besides providing a more healthful alternative to those who prefer the taste of white wine over red, the development is also promising for those who cannot drink red wine, including some migraine sufferers whose condition can be exacerbated by red. At least one wine manufacturer in ...

Spaghetti gets protein boost from corn gluten meal

... he said. We think this may fulfill the demand for healthful food from plant sources. The researchers developed a new processing method for the corn gluten meal, which is widely available as a by-product from milling corn, but has an unpleasant taste. Using water, carbon dioxide and ethanol, they were able to ...

Those who recognize '5-A-Day' message eat the most fruits and vegetables

...getables and a conscious effort to increase eating healthful foods. These and other findings emerged from a nationwide telephone survey of 2,605 adults analyzed by Van Duyn and her colleagues. Drawing upon current models of health behavior, the investigators examined background information such as age and gend...

Nutrition education with a food label focus helps diabetics over 65 meet treatment goals

...er their belief that it was too expensive to eat a healthful diet. One session was conducted in a supermarket so the participants had an opportunity to apply the principles they learned. Participants were also offered guided activities throughout the program to strengthen their knowledge and skills. At each ...

American kids poor food choices: Fewer than 15 percent eat recommended fruits and vegetables

...ous chronic diseasesunless they learn to make more healthful choices for their meals and snacks. Both at snack... other care givers need to help children make more healthful food choices. NHANES III, a federally sponsored survey, shows that 75 percent of American children a...

Heart disease is a pediatric problem: New guidelines point to lifestyle 'training' in childhood

...ypertension, and Obesity in the Young. Initiating healthful lifestyle "training" in childhood can reduce the risk of coronary heart disease in both the individual child and the population at large, write the authors. The "super-sizing" of America's children Rates of obesity have doubled among U.S. young...

Kids need repeated messages, support on healthy eating

...le grades, and with support, they are able to make healthful changes in their eating behavior," says Amanda S. Birnbaum, Ph.D., M.P.H., of the University of Minnesota. The study included 16 schools in the Minneapolis/St. Paul metropolitan area. Nearly 4,000 students filled out surveys for the study. Students w...

More than 70 percent of adults with cancer use alternative therapies

...e also may indicate a patient is motivated to make healthful lifestyle changes. "Such patients may benefit from consultation with a nutritionist, physical therapist or other health-care professional," she said. The survey was based on telephone interviews with 356 adults who had been diagnosed with breast, pro...

New National Academy of Sciences report highlights health importance of nutrients found in almonds

...rtain nutrients, the report included discussion of healthful fats, protein and fiber -- providing more great re...ut, almonds shine on all three counts -- providing healthful fat, protein and fiber -- as a healthful choice in a healthful diet. With a unique combination of n...

Visceral fat loss after dieting is not necessarily responsible for disease risk improvements

...oss on major disease risk factorsindicate that the healthful benefits of weight loss in premenopausal women cannot be attributed to a particular type of fat deposit. Gower, Barbara A et al. Effects of weight loss on changes in insulin sensitivity and lipid concentrations in premenopausal African American an...

Bread crust and stuffing rich in healthy antioxidants

...rusts from their bread, as they may be sacrificing healthful antioxidants. The research findings are scheduled to appear in the Nov. 6 print issue of the Journal of Agricultural and Food Chemistry , a peer-reviewed publication of the American Chemical Society, the world's largest scientific society. Although ...

American Chemical Society plans national meeting in New Orleans March 23-27

... and use The use of a rice milling byproduct as a healthful food product Uncovering the mysteries of pigments in red wine Food safety challenges: microbial and chemical toxins The use of electrical fields to clean up contaminated soils, sediments and groundwater New techniques to strengthen homeland secur...

Anti-bacterial spice that kills food germs on agenda for ACS meeting in New Orleans

...nd use The use of a rice milling byproduct as a healthful food product Uncovering the mysteries of pigments in red wine The use of coal-based jet fuel for high-speed aircraft The use of electrical fields to clean up contaminated soils, sediments and groundwater A look at the Gulf Coast environme...

Work stress can affect how lower-income families eat

...middle-income working adults felt that sacrificing healthful eating was a temporary but necessary price to pay ...hoices were an inevitable part of working and that healthful eating and self-care were incompatible with the demands of juggling work and family needs. Participa...

Family mealtime is more than just sitting at the table

...ble appears to play an important role in promoting healthful eating among adolescents, according to a study published in the March 2003 issue of the Journal of the American Dietetic Association. Researchers from the University of Minnesota found that children ages 11 to 18 who ate meals with their family ...

Nutrition services are an essential component of school health programs

... schools to educate children and help them develop healthful eating habits for life. The full paper, Nutrition ...ting school policies that will assure promotion of healthful food choices, active lifestyles and integrated nutrition education programs is the right place to st...

School changes could help kids be more active, eat better

... All of us have a responsibility to make schools a healthful environment for all students, Sallis notes, and this study shows we can make some progress in that direction. The reasons for the lack of changes in girls physical activity were not clear, they say. Therefore, more research is needed to find ways to ...

1 2

(Date:8/21/2014)... (PRWEB) August 21, 2014 Recently, ... among their patients. Alternative medicine is on the ... to millenials. According to The Fiscal Times, young ... treatments over conventional medicine. , The Fiscal Times ... many millenials are embracing alternative medicine. The article ...
(Date:8/21/2014)... with advanced laryngeal cancer appear to have better ... nonsurgical chemoradiation. , Author: Uchechukwu C. Megwalu, M.D., ... Mount Sinai, New York, and colleagues. , Background: ... are diagnosed each year and squamous cell carcinoma ... Prior to 1991, total surgical removal of the ...
(Date:8/21/2014)... NC -- Researchers have pinpointed the environmental source of ... Southern California for decades. It literally grows on trees. ... of a 13-year-old girl, who spent the summer gathering ... hardest hit by infections of the fungus named ... Cryptococcus , which encompasses a number of species including ...
(Date:8/21/2014)... (HealthDay News) -- Not only is eating better and exercising ... of health-care dollars a year, a new study finds. ... health sciences at Wake Forest Baptist Medical Center in Winston-Salem, ... 2 diabetes patients. Participants ranged in age ... an intensive "lifestyle change program" focused on diet and exercise, ...
(Date:8/21/2014)... The W. Montague Cobb/ NMA ... national voice in the elimination of health disparities, ... the 112th National Medical Association’s (NMA) Annual Convention ... John Ruffin, Ph.D, former Director of the National ... life-long career and innovations have had a significant ...
Breaking Medicine News(10 mins):Health News:Van Uden Center Sees Growth in Alternative Medicine 2Health News:Surgery associated with better survival for patients with advanced laryngeal cancer 2Health News:Fungus deadly to AIDS patients found to grow on trees 2Health News:Getting Healthier a Big Money-Saver for People With Diabetes 2Health News:W. Montague Cobb/NMA Health Institute Honors Three Outstanding Leaders in Health Disparities 2
Other Tags
titantedstinkyhypertensivesdiesellaybeachremovesaceseekpreliminarymitralagesfactquotationsretarded