Tag: "hereditary" at medical news

Immune system protein may be critical in kidney disorders and other diseases

...dentified as the culprit inthe most common type of hereditary kidney syndrome, congenital nephroticsyndrome of the Finnish type. Occuring in one of every 10,000 Finns, thesyndrome results from lack of nephrin and produces kidney damage, as occurs inShaw's research animals that lack CD2AP. This similarity sugge...

UCSF researchers discover new piece of puzzle in cancer development

...osisof cancers. Research may show that people with hereditary cancer are born with abnormalfibroblasts, in which case these abnormal cells could serve as a marker fordiagnosing cancer, said co-author Aria F. Olumi, MD, UCSF, a former UCSFurologic fellow. Alternatively, the development of CAFs could prove to be ...

UI study identifies mechanism that causes cardiomyopathy, exacerbates muscular dystrophy

...he various forms of muscular dystrophy, a group of hereditary diseasescharacterized by progressive muscle weakness and degeneration. LGMD, whichaffects between one in 20,000 and one in 50,000 individuals, involves initialdeterioration of shoulder and pelvic girdle muscles, with relative sparing ofother muscle g...

How the nose knows

...this would mean that fully one-tenth ofhumankind's hereditary code, comprising some 100,000 genes, must be dedicated tosmell receptors -- obviously an impossible situation.If, on the other hand, unique receptors do not exist for each individual smell,how does the olfactory system make sense of a vast variety of...

Intestine Transplant Results Reported At American Society Of Transplantation Meeting

...t results were children with microvillis disease,a hereditary intestinal disease, or gastrochisis, a congenital condition thatcauses the intestine to die. Among adults, those with the best results had adiagnosis of Crohn's disease or a condition that involves severe clotting of themain vessels leading to the i...

Jefferson Scientists Show Tumor Characteristics May Help Explain Tumor Biology And Prognosis

...College are finding that certaincharacteristics of hereditary colorectal cancer tumors may help forecast apatien...tumor biology. The researchers classified hereditary colorectal cancer tumor samples onthe basis of MSI, according to whether it was absent, low or high....

Cedars-Sinai Medical Center Researcher To Present Five Scientific Sessions At 51st Annual Meeting Of American Academy Of Neurology

... disordermay result from a variety of causes, both hereditary and acquired. More than150,000 Americans suffer from ataxia. A subset of ataxias, autosomal dominant cerebellar ataxias (ADCAs), have geneticorigins and impact the cerebellum of the brain, which is involved in thecoordination of muscular movements. B...

1 2 3

(Date:5/22/2013)... New York, New York (PRWEB) May 22, 2013 ... for the nation’s first trial involving a da Vinci ... in the case, the family of a man who allegedly ... is seeking more than $8 million in damages from Intuitive ... watered down its physician training program for the da Vinci ...
(Date:5/22/2013)... IL (PRWEB) May 22, 2013 Nearly ... Veterans’ Appeals (BVA) in fiscal year 2012, with even ... themselves waiting longer for a decision as the agency ... Allsup, which provides veterans disability appeal services. ... of Veterans Affairs. , Although the BVA received 49,611 ...
(Date:5/22/2013)... is a gender gap when it comes to behavior ... does not appear to exist in children in Asia. ... of self-regulation than boys. Self-regulation is defined as children,s ... and persist on a task. It has been linked ... by Oregon State University researchers. , In three ...
(Date:5/22/2013)... 2013 Successful Therapy for Parents ... Psychotherapy in the Silver Lake community of Los ... as progression to existing Parents and Couples counseling ... parenting therapy has always been suggested, but now ... now specializes in all aspects of relationships ...
(Date:5/22/2013)... 2013 Diversity Focus and Handicap This ... The performance promotes awareness that physical disabilities do not ... performance will be held Friday, June 14th at 7:30 ... Tickets for Handicap This! can be purchased at ... the level to which their mind is handicap accessible. ...
Breaking Medicine News(10 mins):Health News:Da Vinci Robot Lawsuits: Bernstein Liebhard LLP Notes Beginning of Jury Deliberations in Nation’s First Trial Involving Alleged Da Vinci Surgery Complications 2Health News:Da Vinci Robot Lawsuits: Bernstein Liebhard LLP Notes Beginning of Jury Deliberations in Nation’s First Trial Involving Alleged Da Vinci Surgery Complications 3Health News:Da Vinci Robot Lawsuits: Bernstein Liebhard LLP Notes Beginning of Jury Deliberations in Nation’s First Trial Involving Alleged Da Vinci Surgery Complications 4Health News:Veterans Disability Appeals See Fewer Decisions in FY2012, Reports Allsup 2Health News:'Boys will be boys' in US, but not in Asia 2Health News:'Boys will be boys' in US, but not in Asia 3Health News:Patricia O’Laughlin Psychotherapy of Los Angeles Now Seeing Adults, Teens and Young Children 2Health News:Handicap This! Comes to Marion, Iowa 2
Other Tags
penniesswallowgabapentinrelievedlocationtanningguardiansleuthresponsibilitywalkspercentagerankingsavoidscoolingminiinvestigated