Tag: "highlight" at medical news

Penn Researchers Create Drug To Help Target Attack On Cancerous Tumors

...ies fasten to the hypoxic regions in the tumor and highlight its oxygen content. Sydney Evans, VMD, Assistant Professor of Veterinary Medicine, has spent the last several years demonstrating the safety and efficacy of EF5 in animal tumor models and says that EF5 has shown no toxicity in animal studies....

Fred Hutchinson Cancer Research Center And Targeted Genetics Corp. Publish Data On Adoptive Immunotherapy For HIV

...se cells to targetand eliminate diseased cells and highlight the potential utility of the REMtechnology in adoptive immunotherapy." Targeted Genetics plans to commercializethe REM technology for adoptive immunothe! rapy, antigen discovery, immune system modulation, genomics and other therapeutic and research u...

Researchers Uncover Clues About Gateway To The Brain

...Worms' interest after images originally designedto highlight cancerous cells also revealed the tissue to be a potential locationfor the p-glycoprotein (Pgp), a known transporter of many molecules across cellsurfaces. He was studying Pgp as a marker for cells that are less amenable tochemotherapy treatment. The...

Active Aging Makes A Difference: World Health Day 1999 Set April 7

...hood, community andnational activities designed to highlight the challenges of an aging population,which affect all aspects of society. In Washington, U.S. Surgeon General Dr. David Satcher will give thekeynote address at the U.S. observance of World Health Day on Wednesday, April7, at 9 a.m., at PAHO ...

Advances In Translational Cancer Research Is Focus Of 90th Annual Meeting Of American Association For Cancer Research

...e Pennsylvania Convention Center. The session will highlight developments in research on breast and prostate cancers, treatments, prevention strategies, cancer genetics, nutrition and other complementary approaches, the consumer's role in cancer research, and special concerns of minority populations. The Publi...

Nonintrusive Imaging Technique Useful For Identifying Language Regions In Kids' Brains

..., unlike traditionalmagnetic resonance images that highlight anatomy. But fidgeting distorts fMRIimages and makes them unusable for evaluating brain function, so few studies ofchildren had been done. Lee and his colleagues used a variety of methods toconvince healthy children ages 7 to 18 to lie still for fMRI...

Patient Characteristics And The Way Patients Are Treated Have Impact On Hospital Costs Of Liver Transplants

...her patient characteristics. Findings of thestudy highlight the clinical, economic, and ethical dilemmas in livertransplantation. Study findings showed that higher donor age and age of recipient were bothassociated with higher costs of liver transplantation. Researchers foundtransplant recipients with donor...

Heart Experts Call For Action Against Missed Opportunities To Prevent Heart Disease In Women

...s Mosca. "Thus, the consensus panel's goal was to highlight the mostimportant strategies for lowering heart disease risk in women." Some of the panel's recommendations reflect new scientific knowledge,such as the findings from the Heart and Estrogen/Progestin Replacement Study(HERS), which found that ...

Mental Health Services Should Aim To Improve Safety To Prevent Suicide And Homicide

...s. The authors say that their amalgamated findings highlight problems of non-compliance with medication regimens, loss of contact between patients and mental health services and drug and alcohol misuse. They say that these problems emphasise the need to develop strategies for preventing such tragic incidents....

Learning with a digital brain

...hite matter --and instruct your portable brain to highlight the structure in vivid coloramidst its otherwise undifferentiated beige tissue? Duke medical students enjoyed just such a capability for the first time thisyear, thanks to a new neuroanatomy teaching program called Sylvius: Fundamentalsof Human Neura...

Hearts N' Parks - an innovative North Carolina program to prevent heart disease launched

... The Hearts N' Parks launch in Charlotte will highlight a children's daycamp where CATCH will be taught, along with a fitness class for seniors, and aUSA Tennis class. A special ceremony with invited guests from throughout theState will also be held. Special events will also be held in most of the 11ot...

Failures following HIV post-exposure prevention provide valuable lessons for warding off future infections

...ex, and the woman became infected. The other cases highlight the importance of reducing HIV exposures and the needfor ongoing counseling, said Roland. In all three instances, people continuedto engage in unprotected sex with known HIV positive partners and/or useinjection drugs despite participation in the PE...

Patient empowerment could improve diabetes care

...uld make some choices themselves.(2) These results highlight the importance of patient education in the treatment of diabetes. By involving individuals in treatment decisions, alerting them to new drug treatments and educating them about the serious nature of their condition, physicians have the potential to i...

New treatment for type 2 diabetes puts insulin back to work

...Endocrinology Centre, Oxford, UK. The new studies highlight the following important effects of rosiglitazone on insulin action: Rosiglitazone reduces insulin resistance . Using an indirect method of analysis, which calculates insulin resistance without invasive tests, investigators reported that rosiglit...

Depression costs UK economy 2 billion a year, conference will be told

...ression, and novel treatments under development. A highlight will be a debate on the role of new generation antidepressants withopposing views- that the new SSRIs (such as Prozac) must supplant olderantidepressants as firstline therapy and, conversely, more traditionaltreatments. Below are a few of the facts a...

Targeted toxins may revolutionize pain therapy

...y, October 28, in Room C124. A pressconference to highlight the findings will be held in room C226 on Wednesday,October 27 at 9:00 a.m....

1999 American Heart Association 72nd Scientific Sessions kit memo

...nying abstract numbers are included. News releases highlight research being presented at Scientific Sessions that association staff believes will be of special interest to reporters and the public. Researchers are available for interviews in "media availability sessions" at times specified in the Daily Log. A...

Social support and confidence predict medication adherence for AIDS patients

...rent issue of Health Psychology. "These findings highlight the need for interventions that help patients organize and manage their medication-taking routines, plan and problem solve how they will handle medication-taking in the context of their other life activities, use strategies to make complex regimens e...

Pharmaceuticals and personal care products

...e "huge gaps in the knowledge base." Daughton will highlight the overarching issues during his presentation, which kicks off the session. (C. G. Daughton, U.S. Environmental Protection Agency, Las Vegas, Nev.; ENVR 29; Monday, March 27, 8:40 a.m.; Hilton Imperial A, Ballroom Level. See page 105 in the final pr...

'Handwriting challenged' doctors to take penmanship class at Cedars-Sinai Medical Center

...ies, like that of the Institute of Medicine, which highlight the need to reduce medical errors. He cited a widely publicized 1999 case in Texas where a jury awarded a woman $450,000 because her husband died from taking the wrong medication. "Because of the doctor's poor penmanship, the pharmacist mistakenly ...

1 2 3 4 5 6 7 8 9 10

(Date:5/18/2013)... Family Magazine of Washington DC was awarded the "Best ... Inc. in the category of Summer Camps in DC ... the areas best in the ultimate guide on parenting, kids ... Brenda Hyde, a mother of four and publisher of Family ... vast resources available to them in the DC Metro area. ...
(Date:5/18/2013)... (PRWEB) May 18, 2013 During Better ... loss should consider the legal protections they have, including ... problems arise with their child’s treatment or hearing aid ... Since 1927, the American Speech-Language-Hearing Association has used the ... and to promote treatment, such as cochlear implants, which ...
(Date:5/18/2013)... 18, 2013 Simple changes in a ... snacks and drinking more water can lead to substantial ... a healthier lifestyle overall. Diet Doc understands ... weight loss can be difficult and often requires the ... plans to help patients get over initial weight loss ...
(Date:5/18/2013)... 2013 6Webs.com is the leader in ... reviews and comprehensive comparisons make 6Webs.com the useful resource ... 6Webs.com just recently finished conducting their assessments of the ... Smythe from 6Webs.com reports, "There has been an increase ... ease of use, expandability and mobility. Combine these features ...
(Date:5/18/2013)... Show And Go Training, the culmination of ... systems that is all about is getting results in the ... http://ShowAndGoTrainingReview.com ’s Stan Stevenson, prompting an investigative review. ... “four phase system” designed to make you faster, stronger, fitter ... working out in the gym. The training manual and exercise ...
Breaking Medicine News(10 mins):Health News:Summer Camps in DC "Best of the Best" Awarded to Family Magazine of Washington DC for Excellence by Follow Media Consulting, Inc. 2Health News:Schachter, Hendy & Johnson PSC Lawyer Says Cochlear Implant Victims Should Know Their Legal Rights 2Health News:Schachter, Hendy & Johnson PSC Lawyer Says Cochlear Implant Victims Should Know Their Legal Rights 3Health News:hCGTreatments / Diet Doc hCG Diets & Weight Loss Plans Announce the Best Weight Loss Through New Whole Foods, Healthy Snacks and Prescription Strength hCG Treatments 2Health News:hCGTreatments / Diet Doc hCG Diets & Weight Loss Plans Announce the Best Weight Loss Through New Whole Foods, Healthy Snacks and Prescription Strength hCG Treatments 3Health News:Best Wireless Home Security System Companies Released by 6Webs.com 2Health News:Show And Go Training: Review Examining Eric Cressy's Workout Program Revealed 2
Other Tags
sarawakmalaysianweevilnicetrendupwardpredisposingemphasiscouricmovieadvisestraymitigatesolicitousnessgastroenteritisgatorade