Tag: "humans" at medical news

New study in 'Nature' demonstrates protection against cell death during heart attack

...al trials. Cyclosporin already has been tested in humans and has been well-tolerated acutely."...

UCSF study offers insight into human circadian rhythms

...a 24 hour period -- about which little is known in humans at the molecular level. As the findings hint that the genetic mutation might play a role in depression, the scientists are now exploring this possibility, as well. "Evidence suggests that circadian rhythms may have a fundamental role in numerous beha...

Acupuncture found to lower elevations in blood pressure

...elevated blood pressure rates; these same sites on humans are on the inside of the forearm slightly above the wrist. The researchers found that acupuncture alone had no effect on blood pressure. Next, they added electrical stimulation to the acupuncture treatment by running an electrical current through th...

NIAID initiates trial of experimental avian flu vaccine

...vian influenza, since 1997 when the first cases in humans were reported. The initiation of this vaccine tria...rmed cases of and 46 deaths from H5N1 infection in humans reported to the World Health Organization. To date, there has been a small number of cases where hum...

Protein that helps skin cancer spread identified by Stanford researchers

...man cells. "Cancer processes are very different in humans and mice," Khavari said. If they'd found these results in mouse cells, the group would still need to prove that the fragment is relevant for humans. By studying human cells, the group has already shown the fragment's relevance-now it's just a matter ...

Study shows acrylamide in baked and fried food does not increase risk of breast cancer in women

... levels 1,000 to 100,000 times greater than levels humans are exposed to through diet. The researchers assessed acrylamide intake of more than 43,000 women, including 667 breast cancer cases, who were enrolled in the Swedish Women's Lifestyle and Health Cohort. Acrylamide intake was determined from food fre...

Ethical discussion should come before research

...mice with human brains. "When the barrier between humans and animals is broken down, could science unintent...ened gap between lab research and potential use in humans means that scientists must consider ethical issues before experimentation begins. Even though these ...

Rhesus monkeys reason about perspectives of others in obtaining food

...ve conditions, the monkeys were competing with the humans for the grapes. The 115 monkeys tested only took the grape when they could tell that a person was not looking at them. The experiments varied from one person looking at the monkey and the other with their back turned, to one person having their eyes ...

Binge drinking can impair both mood and cognitive performance

... author for the study. "For instance, animals and humans who have undergone several withdrawals from alcohol will develop convulsions during withdrawal whereas their counterparts who have received the same amount of alcohol but have not experienced repeated withdrawal will not. Thus, we set out on this st...

Philanthropist Paul F. Glenn launches labs for aging research at Harvard Medical School

...gh there has been much interest in the SIRT1 gene, humans actually possess seven SIRT genes, known as SIRT1-7. It is suspected that many, if not all, of these genes control aspects of the aging process. Sinclair's group is testing whether these genes can forestall the aging process and increase the heaths...

Common anesthetics appear safe for developing fetal brain

...ircumstances that more closely parallel that which humans would experience. "The results of this investigation suggest that the moderate inhalation anesthetic exposure during pregnancy may not be deleterious to the fetus," said lead researcher James D. Reynolds, Ph.D., research director of women's anesthesi...

Studies underscore genetic involvement in nicotine addiction & aggressive hostility

...on in nicotine tolerance. That may explain why in humans (the gene is found in essentially all animals), CH...link between nicotine and ethanol intake, which in humans means smoking and drinking." In addition, the finding could help to account for the tendency of sm...

Potential treatment for Fragile X Syndrome demonstrated in fruit fly model

... FDA-approved drug used to treat other ailments in humans such as bipolar disorder. "The big take-home message from our work is that maintaining proper regulation of mGluR signaling is a conserved function of the dFMR1 and FMRP proteins and that loss of dfmr1 function in flies leads to at least a subset of ...

When the brain, not the ears, goes hard of hearing

...their older counterparts. While dozens of genes in humans and mice are known to contribute to congenital deafness, none has been linked to age-related hearing loss in humans. The latest studies offer several promising leads in genes that affect the functioning of brain chemicals like glutamate and GABA, imp...

Investigational transplant drug effectively preserves kidneys while avoiding toxic side effects

...ake a bold step toward studying this medication in humans to determine if it is a better choice than the current standard of care. Working with nonhuman primates enabled us to expedite the research process by four or five years." The research team recently completed a phase II clinical study comparing LEA2...

Diagnosis of prions in patients should utilize novel strategy, team says

...hey say. (A definitive diagnosis of the disease in humans is made only on autopsy, when a neuropathologist c...approach to the diagnosis of prion disease in both humans and livestock," says Safar. More broadly, the scientists say, the high sensitivity of the CDI sugges...

Lead in the environment causes violent crime, reports University of Pittsburgh researcher at AAAS

...rding to the U.S. Environmental Protection Agency, humans can encounter lead through deteriorating paint and dust, air, drinking water, food and contaminated soil. Sources of lead are plentiful until the 1970s lead was used in paint, gasoline and older water pipes. Today, much of that lead is still out the...

Natural selection as we speak

...nant role in shaping grammars. Blevins argues that humans learn sound patterns on the basis of their exposure to hundreds of thousands of examples of them in the first years of life. Where universal tendencies exist, they are emergent properties of language as a self-organizing system. Other participants...

Test could improve detection of prion disease in humans

...red type of protein normally found within cells in humans and other organisms. These abnormal prion proteins appear to convert other, normal prions to an abnormal shape. Many scientists now believe this conversion process leads to several dementing diseases in humans, including CJD. Similar diseases in anim...

Uric acid may help reduce effects of spinal cord injury, Jefferson researchers find

...hat seen in the mice. "Raising uric acid levels in humans similarly to the rise we cause in the mouse should be sufficient to block peroxynitrite," Dr. Hooper says. "Our natural levels of uric acid are not sufficient. Moreover, someone with lower levels who has a spinal cord injury could definitely suffer g...

1 2 3 4 5 6 7 8 9 10

(Date:5/22/2013)... 22, 2013 Cedars-Sinai Heart Institute is honoring ... pioneer in modern mitral heart valve repair, Alain ... Corday, MD, International Prize in Heart Research. The ... recognize physicians and scientists conducting groundbreaking research, or ... medicine. , Carpentier is a leading ...
(Date:5/22/2013)... A new study provides neurobiological evidence for ... in people with insomnia, which may have implications ... , "Insomnia has been consistently identified as a ... Franzen, PhD, an assistant professor of psychiatry at ... in the brain circuitry underlying emotion regulation may ...
(Date:5/22/2013)... May 22, 2013 Digital Advertising Agency, ... behalf of its social media management client, Primal ... year's supply of the all-natural organic deodorant. The contest ... of the rapidly-growing start-up deodorant company based in Tampa, ... contest or sweepstakes on a Facebook page is a ...
(Date:5/22/2013)... (PRWEB) May 22, 2013 DiscountFurnaceFilter.com ... quality merchandise ranging from furnace filters, dehumidifiers, fans, ... is excited to add Stadler Form's product line ... summer product line (fans, aroma diffusers and dehumidifiers) ... Form’s Otto Fan is the perfect combination of ...
(Date:5/22/2013)... York, NY and Troy, NY (PRWEB) May 22, ... Medicine at Mount Sinai and Rensselaer Polytechnic Institute ... educational programs, research, and development of new diagnostic ... alliance was commemorated in a signing ceremony on ... initiative to use their expertise—Rensselaer’s in engineering and ...
Breaking Medicine News(10 mins):Health News:Heart valve repair innovator receives Cedars-Sinai Heart Institute's Corday Prize in Heart Research 2Health News:Study shows that insomnia may cause dysfunction in emotional brain circuitry 2Health News:Social Media Management Firm, 21Digital, Launches National Facebook Sweepstakes for Client, Primal Pit Paste 2Health News:DiscountFurnaceFilter.com Now Offers Stadler Form Products - Providing Solutions to All Your Summer Needs 2Health News:Icahn School of Medicine at Mount Sinai and Rensselaer Polytechnic Institute Announce Academic Collaboration 2Health News:Icahn School of Medicine at Mount Sinai and Rensselaer Polytechnic Institute Announce Academic Collaboration 3Health News:Icahn School of Medicine at Mount Sinai and Rensselaer Polytechnic Institute Announce Academic Collaboration 4Health News:Icahn School of Medicine at Mount Sinai and Rensselaer Polytechnic Institute Announce Academic Collaboration 5Health News:Icahn School of Medicine at Mount Sinai and Rensselaer Polytechnic Institute Announce Academic Collaboration 6Health News:Icahn School of Medicine at Mount Sinai and Rensselaer Polytechnic Institute Announce Academic Collaboration 7
Other Tags
deficitmammarymissilesguidedcoloradoinfluencesculturealoneopensdocumentedruinousmethamphtetamineflycheckfacedmetacognition