Tag: "hypothesis" at medical news

Jefferson scientists find how HIV causes dementia

...those who do not take the drugs. "The overarching hypothesis has been that HIV infects brain cells called macrophages and microglia," he explains. These cells produce an array of substances called cytokines and chemokines, which kill neurons. "It's thought that HIV doesn't kill neurons directly, but rather, it...

Sounds of New York, evidence for a preferred ear, ultrasound for the eye

...es which increase nasal ventilation. Testing this hypothesis that humming creates resonances in the nasal tract and sinus cavities, the researchers are now exploring the various factors that make humming most effective in clearing the sinuses of gas. For example, they have found that modulating, or varying, t...

Hormone may offer hope for treating some behavioral disorders

...l response of the amygdala. "We wanted to test the hypothesis that administration of secretin alters amygdala re...ating disorders. "Results of our study support the hypothesis that secretin alters amygdala responsiveness to affective stimuli," concludes Yurgelun-Todd. Inducin...

Large families and animals keep allergies at bay

...or preventing atopic dermatitis, but challenge the hypothesis that infectious diseases in infancy protect against its development, they conclude....

CellCept(R) registry data demonstrated superior long-term organ transplant outcomes

...f the US Liver Transplant Experience, examined the hypothesis that triple therapy with MMF + Tacro + CS was associated with improved patient survival and graft survival. Investigators analyzed data from 11,670 adult primary liver transplant recipients 18 80 years old (7,204 Tacro + CS; 4,466 MMF + Tacro + CS...

National Academies news: vaccines and autism

...answers. Without supporting evidence, the vaccine hypothesis does not hold such promise." The report updates t...he release of toxins that lead to autism. Another hypothesis suggests that the MMR vaccine might stimulate the release of immune factors that damage the central ...

How brain gives special resonance to emotional memories

...ion on memory, and the evidence for the modulation hypothesis was disparate and inconclusive. Thus, this is the first direct evidence for the modulation hypothesis in humans." What's more, said Cabeza, "We also found indications that some regions within the medial...

July/August 2004 Annals of Family Medicine tip sheet

...mportance for clinicians to reframe their original hypothesis and 2) the need for clinicians to learn cognitive and emotional strategies that might help them manage difficult or tense patient encounters so those encounters are not ended precipitously. Screening for Syphilis Infection: Recommendation Statemen...

Isolated soy protein shown to benefit type 2 diabetics, study indicates

...of additional dishes or drinks in their diet. "Our hypothesis was that we could slow down or maintain the same protein levels in the urine by introducing soy protein," said Lea Ann Carson, a research dietitian in the department of food science and human nutrition at Illinois. "We actually had a reduction." Tho...

Certain components of the brain's 'executive functions' are compromised early in abstinence

...cutive functioning after abstinence, he said. One hypothesis is that there might be a different pattern of executive dysfunction among older folks during abstinence. On a related note, we really need to look at the implications of this research for adolescent alcoholics. Their executive functioning is not ye...

Cleveland stem cell investigators awarded $3.1 million

...ing Hematopoietic Stem Cells," a study to test the hypothesis that deterioration of blood stem cells in bone marrow contributes to anemia and bone marrow failure in the aging process. The ability to divide and faithfully produce more cells is an important part of a stem cell's ability to contribute therapeutica...

Soy likely doesn't affect fertility, according to research in monkeys

...o those of women, Kaplan and colleagues tested the hypothesis that the estrogen in soy can affect menstrual cycles. "Our study was designed to determine whether a soy supplement containing twice the level of plant estrogen consumed by Asian women would alter any aspect of the menstrual cycle or ovarian funct...

Study reports genetic susceptibility to alcoholism in NMDA receptor

...less sensitive to ketamine. "This study confirms a hypothesis that people with a family history of alcoholism are more vulnerable to alcoholism because they are less likely to get the 'warning signs' of when to stop drinking," said Ismene Petrakis, M.D., associate professor of psychiatry. "In the right environm...

High-fat diets hammer memory, more than a waistline worry

...Our new findings provide the first support for the hypothesis that diet can modify an individual's vulnerability to cognitive impairments caused by these brief periods of low oxygen concentrations such as encountered in patients with sleep apnea," says Gozal. "These results suggest that an improved diet can be ...

New protein associated with aggressiveness in breast and ovarian cancer

...cell proliferation," says Mills. "But that working hypothesis has not yet been proven." The other vital role of Rab25 is to activate the critical "PI3 kinase/AKT/PTEN" protein pathway involved in cell survival and growth. This pathway, however, is known to contain multiple tumor suppressor genes and oncogenes "...

Supervised treatment interruptions fail to control HIV-1 viremia

...ne response could control the virus." To test this hypothesis the researchers did an open-label trial of STIs; they published data from a six-month follow-up in the Nature paper. "The key finding was that we were able to get at least transient control of the virus in all eight persons studied, and in five of ei...

New insights into hormone therapy highlight when estrogen best aids brain

...ats, Bimonte-Nelson says. "The results support the hypothesis that progesterone negatively affects memory during aging," says Bimonte-Nelson. "The negative outcome of several studies evaluating the combined estrogen/progesterone HT may be due, in part, to unfavorable effects of progesterone. Future research to ...

Further evidence reveals the association between periodontal disease and coronary artery disease

...heart attack or stroke, and the study proposes two hypothesis for this occurrence. One reason is that periodonta..., toxic substances, and other agents.) Another hypothesis is based on several studies that have shown that periodontal infections can be correlated with incre...

Research on nerve cell circuitry reveals clue about schizophrenia

... as slight noise in the background." To test their hypothesis that RGS4 is involved in brain signaling, Hegde and colleagues injected the RGS4 protein in a nerve cell and measured "calcium current," a marker for the levels of neurotransmitters released by nerve cells. They found that the protein increased level...

News tips for Sunday, November 7, 2004

...olesterol and body mass index. This "supports the hypothesis that increased social support, particularly related to being married, is associated with reduced prevalence of established CVD risk factors," the authors said. 9 a.m. Abstract 3531 Adherence to ACC/AHA PCI guidelines equals better outcomes. A m...

1 2 3 4 5 6 7 8 9 10

(Date:4/17/2014)... PLOS Pathogens , children who live in regions of ... immune response to infection with malaria parasites that may ... and illness and partially control the growth of malaria ... develop future interventions that prevent or mitigate the disease ... 200 million cases of malaria occur worldwide, resulting in ...
(Date:4/17/2014)... Two recent papers by a University of Colorado ... scientists develop treatments or vaccines for Dengue fever, ... other disease-causing flaviviruses. , Jeffrey S. Kieft, PhD, ... the School of Medicine and an early career ... colleagues recently published articles in the scholarly journals ...
(Date:4/17/2014)... biology team has created a new technology for ... could travel the body and selectively target cancer ... biological devices that monitor and modify human physiology ... However, no existing technology enabled bioengineers to build ... and respond in a customized fashion. , "The ...
(Date:4/17/2014)... estimated that as many as 10 million older Americans ... loneliness and isolation. , However, new research a ... older Americans for six years found that Internet ... depression by more than 30 percent. , "That,s a ... University professor of telecommunication, information studies and media who ...
(Date:4/17/2014)... 17, 2014 By discovering a new mechanism that ... stroke, researchers at UC Irvine and the Salk Institute ... limit or prevent stroke-induced brain damage. , A complex ... of death and primary reason for disability in the ... stroke and lets blood-borne material into the brain, causing ...
Breaking Medicine News(10 mins):Health News:Study sheds light on how the immune system protects children from malaria 2Health News:CU researchers discover target for treating dengue fever 2Health News:Building 'smart' cell-based therapies 2Health News:Internet use can help ward off depression among elderly 2Health News:Study IDs new cause of brain bleeding immediately after stroke 2
Other Tags
architectsbeaverrunawaycaspaseclindamycinplentifulpertussisimmunogenicityallergenillnessessupplementsherbalprofessorshipbassetspaceddocument