Tag: "identifies" at medical news

Exercise for special populations, sensory research, factors impacting rehabilitation top issues

...ams vary--more research needed, pg 729 This study identifies the current methods of evaluation and instruction used in VA blind rehabilitation centers and vision impairment center to optimize remaining sight (VICTORS) programs. A questionnaire was mailed to all VA blind rehabilitation centers and VICTORS progr...

Genetic testing can identify ischemic and nonischemic heart failure

...xpression to compare to a diseased "test" set that identifies the cause of heart failure, the Hopkins team assembled a 90-gene profile to determine which type of heart failure had most likely developed. Results showed the test profile to be highly accurate, with 90 percent specificity. The findings could, if...

News tips for Sunday, November 7, 2004

...r function. 4:45 p.m. Abstract 1930 Early ECG identifies cardiac abnormalities in newborns. Should newborn infants be screened for heart rhythm abnormalities? Italian investigators, who previously had found increased risk of sudden infant death syndrome among infants with Long QT Syndrome (LQTS), sought ...

Estrogen-associated COX-2 pathways explain protection from heart disease in female mice

...rovides insight into how this risk might occur and identifies potential biomarkers of this evolving risk. The work was funded by the National Heart, Lung, and Blood Institute of the National Institutes of Health. Other Penn researchers on this paper were Karine M. Egan, John A. Lawson, Susanne Fries, Daniel J....

Smokers' lung cancer risk identified in CT screening study

...ical Center in New York City. "Annual CT screening identifies a high percentage of Stage I diagnoses of lung cancer, the most curable form of lung cancer," Dr. Henschke said. "Our study found that deaths from Stage I lung cancer were surprisingly low after surgery, but only if treatment is pursued. Delaying tre...

Fred Hutchinson receives $9.7 million to lead early detection consortium

...h an artificial-intelligence computer program that identifies the discrepancies in protein patterns between people with and without cancer. Proteins linked to cancer may then serve as biomarkers to detect early disease and predict responsiveness to therapy or the likelihood of recurrence. Such biomarkers also c...

Researchers describe how human blood stem cells transform themselves to repair injured animal hearts

...eins, found only on human cells; troponin T, which identifies a myocyte, whether human or mice; and VE-cadherin to pinpoint endothelial cells in both species. They found that one percent of the cells expressed both HLA and troponin T, which meant that they were human-derived cardiac myocytes. "That is a high f...

A much-needed shot in the arm for HIV vaccine development

...he collaboration of over 140 scientists worldwide, identifies the major scientific roadblocks facing HIV vaccine development, outlines a strategic approach to addressing them, and proposes an innovative collaborative model that ensures that researchers across the globe are harnessing their efforts towards a com...

Study shows strengths, gaps in quality of care for kids in California's public mental health clinics

...cords at California's public mental health clinics identifies strengths and gaps in quality of care. Published in the February edition of the Journal of the American Academy of Child and Adolescent Psychiatry, the study examines safety and appropriateness of care for attention deficit hyperactivity disorder (A...

Thinking of prepositions turns brain 'on' in different ways

...ass of water. Previous research with normal brains identifies this area as important also in the knowledge and meaning of prepositions. The patients with damage to the supramarginal gyrus did not score high on the tasks that evaluated their knowledge of prepositions that dealt with space. In comparison...

January/February Annals of Family Medicine tip sheet

...CIANS DIAGNOSE DEPRESSION? This qualitative study identifies three processes used by clinicians to sort through... RESEARCH The study of a community advisory board identifies key issues for engaging the community voice in participatory research in mental health and primary c...

Minorities who experience pain don't receive the same care as Caucasians

...nd differences. "Most interestingly, each article identifies commonalities in response to pain, the adverse impact of pain, and the under-treatment of pain across racial and ethnic groups that can be easily overlooked in our efforts to identify differences." Topics covered include differences in response to pa...

Best treatment for mild or moderate depression unclear

...y that the study on which the guidelines are based identifies evidence supporting problem solving therapies and counselling, but evidence on other interventions is weak or absent. Although these shortcomings are acknowledged, the guidelines offer limited advice on how to determine whether or not a particular ...

Services for children: Training needed to tackle complexity of new labour's joined-up approach

...f multi-disciplinary and multi-agency work. And it identifies lack of training in effective management of multi-agency teams and managing change as two key issues which must be addressed. Researchers investigated five multi-agency teams operating in children's services in England, covering youth crime, mental h...

NYU psychology researchers show how attention enhances visual perception

...n Neuron shows the neural basis of this effect. It identifies an increase in neural activity in areas of the brain that respond to the attended stimulus--that is, to the information that is selectively processed at a given location. In this study, the researchers presented observers with two patches simultaneo...

Clot-busting drugs may help detect potentially deadly leg clots

...Georgia researchers working to improve a test that identifies potentially deadly blood clots in the legs. "This study is a fairly simple concept," says Dr. Vincent J.B. Robinson, nuclear cardiologist at MCG and the Veterans Affairs Medical Center in Augusta and lead author of a study in the February issue of C...

Test could improve detection of prion disease in humans

...California, San Francisco, found that CDI not only identifies prions in human brain tissue but is faster and far more precise than the standard immunological detection methods, which only detect a small fraction of the infectious prions that may be in the brain. The finding appears in the March 1, 2005 issue of...

USC dental researchers develop first test for predicting cavities in children

...her dental future. A different version of the test identifies the particular teeth at risk, Denny said. And the test's specificity may reduce the cost and increase the effectiveness of prevention. "It's possible that in the future - even though a kid might be at very high risk for getting a large number of cari...

Innovation prize finalists announced in 'Science of Better'

..., in the U.S. and across the world, and frequently identifies unfolding trends in business and government. This is the 34th year of the prestigious competition, which has recognized techniques that have changed our technical and business landscape. These include dynamic pricing, which revolutionized pricing in ...

New substance that improves the photodetection of bladder cancer gains market approval

...e is used again as a surgeon or physician visually identifies and cuts out the cancerous tissue. This "white light" examination and resection is quite difficult for flat lesions and the experience of the individual urologist or surgeon is a considerable variable factor in successful detection. The recurrence ra...

1 2 3 4 5 6 7

(Date:5/22/2013)... 22, 2013 Cedars-Sinai Heart Institute is honoring ... pioneer in modern mitral heart valve repair, Alain ... Corday, MD, International Prize in Heart Research. The ... recognize physicians and scientists conducting groundbreaking research, or ... medicine. , Carpentier is a leading ...
(Date:5/22/2013)... A new study provides neurobiological evidence for ... in people with insomnia, which may have implications ... , "Insomnia has been consistently identified as a ... Franzen, PhD, an assistant professor of psychiatry at ... in the brain circuitry underlying emotion regulation may ...
(Date:5/22/2013)... May 22, 2013 Digital Advertising Agency, ... behalf of its social media management client, Primal ... year's supply of the all-natural organic deodorant. The contest ... of the rapidly-growing start-up deodorant company based in Tampa, ... contest or sweepstakes on a Facebook page is a ...
(Date:5/22/2013)... (PRWEB) May 22, 2013 DiscountFurnaceFilter.com ... quality merchandise ranging from furnace filters, dehumidifiers, fans, ... is excited to add Stadler Form's product line ... summer product line (fans, aroma diffusers and dehumidifiers) ... Form’s Otto Fan is the perfect combination of ...
(Date:5/22/2013)... York, NY and Troy, NY (PRWEB) May 22, ... Medicine at Mount Sinai and Rensselaer Polytechnic Institute ... educational programs, research, and development of new diagnostic ... alliance was commemorated in a signing ceremony on ... initiative to use their expertise—Rensselaer’s in engineering and ...
Breaking Medicine News(10 mins):Health News:Heart valve repair innovator receives Cedars-Sinai Heart Institute's Corday Prize in Heart Research 2Health News:Study shows that insomnia may cause dysfunction in emotional brain circuitry 2Health News:Social Media Management Firm, 21Digital, Launches National Facebook Sweepstakes for Client, Primal Pit Paste 2Health News:DiscountFurnaceFilter.com Now Offers Stadler Form Products - Providing Solutions to All Your Summer Needs 2Health News:Icahn School of Medicine at Mount Sinai and Rensselaer Polytechnic Institute Announce Academic Collaboration 2Health News:Icahn School of Medicine at Mount Sinai and Rensselaer Polytechnic Institute Announce Academic Collaboration 3Health News:Icahn School of Medicine at Mount Sinai and Rensselaer Polytechnic Institute Announce Academic Collaboration 4Health News:Icahn School of Medicine at Mount Sinai and Rensselaer Polytechnic Institute Announce Academic Collaboration 5Health News:Icahn School of Medicine at Mount Sinai and Rensselaer Polytechnic Institute Announce Academic Collaboration 6Health News:Icahn School of Medicine at Mount Sinai and Rensselaer Polytechnic Institute Announce Academic Collaboration 7
Other Tags
deficitmammarymissilesguidedcoloradoinfluencesculturealoneopensdocumentedruinousmethamphtetamineflycheckfacedmetacognition