Tag: "identify" at medical news

Powerful AIDS Drugs May Promote Heart Disease

...nd to be preexistingconditions. This study did not identify the culprit, but all the women had takencocktails containing protease inhibitors. The study also documented another side effect. Of 116 women who were treatedwith the popular drug protocol at the Miriam Hospital Immunology Center inProvidence, R.I., ...

DFG To Fund Four New Research Units

...e of the new media. The scientists also intend to identify user-oriented ways of providing information in the Internet and study empirically which methods of working with the new media have developed. Mathematicians at the universities of Heidelberg and Mannheim will embark on a study of arithmetic, i.e. ...

Brain Regions Identified That Influence What We Remember Or Forget

... a half hourlater, Brewer said. They were asked to identify which photos they clearlyremembered seeing earlier, which ones looked familiar but that they weren'tcertain they had seen earlier, and which ones they did not recall seeing at all. "Several regions of the brain are active when one processes a photogr...

Unsticking The "Glue" In Blood Cells Could Save Lives

... that thedisease will spread elsewhere. "I want to identify the molecules on theplatelets and the tumorcells that allow them to stick together," he says. "Then, presumably, if youinject agents thatprevent this adhesion, the body's natural defenses will recognize the cancercell and fight it." With these a...

University Of North Carolina-Chapel Hill (UNC-CH) Study: Parents' Wishes, Uncertainty Determine Resuscitation Of Premature Infants

...rt because of the controversy. "We wanted to identify whether physicians' or parents' preferences primarilydetermine the amount of treatment, to examine what controls resuscitationdecisions and to learn whether initiating intensive care significantly postponesdeath among the babies that don't survive." ...

Study Ties Cerebral Palsy To Inflammation And Blood-Clotting Abnormalities

...irm a diagnosis of CP has made it verydifficult to identify what causes the disorder. "By the time the child ... of these substances might one dayallow doctors to identify babies at risk of developing the disorder. If so,they might be able to prevent some brain damage wi...

Penn State Chemist Identifies New Lime Aroma Component

... use an old-fashioned device -- the human nose, to identify odorants and to detect changesin the aroma. "The human nose can detect odors at far lower levels than instruments,"she says. "The human nose is the most sensitive detector on the market tomeasure aroma intensities. "We take very sim...

University Of Florida Researchers Hope To Ease Asthma Pains And Provide A Sigh Of Relief

...nd pharmacology. "Unfortunately, even if we identify a compound with the potential totreatasthma in the laboratory as a result of Nowicki's efforts," Richards said,"it requires a significant amount of time to ensure that it is safe enoughto test on people." Richards said such a process may take ...

Beyond Pharmaceuticals: Business And Academic Leaders Forecast The Future Of "Combinatorial Chemistry"

...ts remarkable promise, he will describe efforts to identify and refine avariety of luminescent materials and c...dying thecompounds in his library may allow him to identify structure-functionrelationships that would enable him to design-rather than simply screenfor-improve...

Altered Brain Chemistry In Bulimia Nervosa Patients Persists After Recovery, According To UPMC Researchers

...evelop bettertreatments in the future and possibly identify people at risk for the disorderbefore it occurs." Bulimia nervosa affects about 1 to 3 percent of women and most commonly occursin women who are of normal body weight. Onset is usually during adolescence andis characterized by bingeing and purging, ...

Prenatal Cocaine Exposure Leads To Lower Child IQ Scores, Language Skills

...peaking abilityand involve asking a child to identify what is in a picture. Expressivelanguage tests measure comprehension by asking a child to answer questions. Children in the cocaine-exposed group, on average, had IQ scores 3.26lower than children who were not exposed to the drug. T...

Encapsulating Insulin-Producing Cells For Possible Diabetes Therapy

...etes therapy. But the immune system would normally identify suchtransplanted islets as "foreign," and thus target them for destruction. The microcapsules being developed in Grinstaff's lab would avoid thisdilemma by not allowing large molecules such as immunoglobin G (IgG) antibodies,a key part of the...

Get Me To The ER On Time

... involvescommunity volunteers and staff working to identify ways to improve the local"chain of survival." Strengthening the "chain of survival" will be accomplishedthrough a variety of activities chosen after assessing each link to identifypriority areas for improvement. Co-authors are Mickey Eisenberg, M.D....

For High-Volume Chest Pain Centers, Aggressive Use Of Nuclear Imaging Technology Saves Money, Shortens Hospital Says

...maging technologies in a more aggressive manner to identify patients atthe highest risk for heart attack, a pilot study has shown. An economic analysis demonstrated that patient costs for care using adiagnostic technique called "perfusion imaging" were almost half that ofpatients treated in the conven...

Signal Pharmaceuticals Announces Positive Results In Preclinical Study Of Novel Drug Leads For Treatment Of Osteoporosis

...screening and medicinal chemistry capabilities, to identify the two series of drug leads reported ontoday. S...ies to map gene-regulating pathways incells and to identify proprietary molecular targets that activate or deactivategenes and result in disease. Signal is adv...

Low "Health Literacy" Increases Hospitalizations

...ifying those with low literacy skills because most identify illiteracy withpersons who are slow learners, poor, immigrants, and minorities, while in fact"most people with low literacy skills are of average intelligence and functionreasonably well by compensating for their lack of reading skills." They...

Study Offers Hope For Immune Reconstitution After HIV Infection

...gues hypothesized that the presence of TRECS would identify Tcells that had recently left the thymus and thus serve as a marker of thymicoutput. Using sensitive DNA tests, the scientists showed that TRECs are present in naïveT cells - those that have not yet encountered their specific antigen - but notin ...

Radically New Type Of Surgery Tested On First Patient

...es a small piece of tissue, enabling physicians to identify a tumor,determine whether it is malignant and plan appropriate treatment. The first patient, a 31-year-old man, underwent the magnetic surgeryDec. 17 at Barnes-Jewish Hospital in St. Louis. Dacey used computer-controlledsuperconducting magnet...

Comprehensive Heart Failure Program At Cedars-Sinai Medical Center

...ugh this two-pronged approach, researchers hope to identify at-risk patientsmuch earlier when interventions ar... physicians and others in thecommunity, we hope to identify at-risk patients early, provide appropriatetreatment early and track the results for even better hea...

Ultrasound Measurement Of Neck Arteries May Help Doctors Identify Older Adults At Increased Risk For Heart Attack And Stroke

... explained. "It may be difficult for clinicians to identify older patientswith cardiovascular disease who don'... to provide additional information needed to "help identify asymptomaticpersons who would benefit from aggressive prevention measures," he said. Such ag...

1 2 3 4 5 6 7 8 9 10

(Date:4/17/2014)... PLOS Pathogens , children who live in regions of ... immune response to infection with malaria parasites that may ... and illness and partially control the growth of malaria ... develop future interventions that prevent or mitigate the disease ... 200 million cases of malaria occur worldwide, resulting in ...
(Date:4/17/2014)... Two recent papers by a University of Colorado ... scientists develop treatments or vaccines for Dengue fever, ... other disease-causing flaviviruses. , Jeffrey S. Kieft, PhD, ... the School of Medicine and an early career ... colleagues recently published articles in the scholarly journals ...
(Date:4/17/2014)... biology team has created a new technology for ... could travel the body and selectively target cancer ... biological devices that monitor and modify human physiology ... However, no existing technology enabled bioengineers to build ... and respond in a customized fashion. , "The ...
(Date:4/17/2014)... estimated that as many as 10 million older Americans ... loneliness and isolation. , However, new research a ... older Americans for six years found that Internet ... depression by more than 30 percent. , "That,s a ... University professor of telecommunication, information studies and media who ...
(Date:4/17/2014)... 17, 2014 By discovering a new mechanism that ... stroke, researchers at UC Irvine and the Salk Institute ... limit or prevent stroke-induced brain damage. , A complex ... of death and primary reason for disability in the ... stroke and lets blood-borne material into the brain, causing ...
Breaking Medicine News(10 mins):Health News:Study sheds light on how the immune system protects children from malaria 2Health News:CU researchers discover target for treating dengue fever 2Health News:Building 'smart' cell-based therapies 2Health News:Internet use can help ward off depression among elderly 2Health News:Study IDs new cause of brain bleeding immediately after stroke 2
Other Tags
architectsbeaverrunawaycaspaseclindamycinplentifulpertussisimmunogenicityallergenillnessessupplementsherbalprofessorshipbassetspaceddocument