Tag: "identify" at medical news

Turning off cancer shield may allow safer cancer therapy

...herapy to be administered to improve cure rates.To identify a compound that could block the action of p53, the researcherscreated a model of normal tissue containing a reporter gene that turns cellsblue when p53 is activated. They treated the cultured mouse cells with 10,000man-made compounds to see if any wo...

New test can better uncover hidden breast cancer

... better than everbefore. "Our findings may help to identify those patients with breast cancer who are atgreate...cer cells, which usually are extremelydifficult to identify by conventional methods, can be detected through this newtechnique. To study the effectiveness of th...

UT Southwestern to study lipodystrophy syndrome in HIV-infected patients

...ssociated with lipodystrophy." Researchers hope to identify the role protease inhibitors play in causing thesyndrome and to understand the mechanisms by which these drugs cause fatredistribution. In addition, they hope to clarify the basis of metaboliccomplications such as diabetes and high triglycerides. The...

Some HIV patients show no viral rebound after stopping drugs

...nfected people are unclear. But ifresearchers can identify the mechanism by which the immune response isstrengthened in patients who interrupted treatment, they might be able to designvaccines that infected patients could take to keep the virus at low levels evenwhen medication is halted. "We don't w...

UCSF finding could lead to a new class of painkillers

...pain-sensing cells would prevent us from having to identify blocks for every inflammatory mediator," said Levine. "I think this enzyme will prove to be the central signaling pathway by which most chemical mediators act on pain-sensing neurons." For more than a decade, researchers have thought that the protei...

Failures following HIV post-exposure prevention provide valuable lessons for warding off future infections

..."The most important thing we can do is help people identify barriers toprotecting themselves and offer resources to overcome those barriers." The PEP project, jointly run by the UC San Francisco AIDS Research Instituteand the San Francisco Department of Public Health, offers comprehensivetreatment to high-ris...

HIV's deep pocket may reveal vulnerability

...nformation gained from this study in an attempt to identify compounds lackingthe protein fragment entirely. Such compounds would, in theory, be still easierto turn into drugs. Though this research involved HIV, it could have application to a number ofother viruses, including influenza and Ebola. "We do belie...

MGH researchers identify angiogenesis inhibitor in gallbladder cancer

...icewith subcutaneous tumors or with no tumors. To identify which factors might be involved in the observed suppression ofangiogenesis, the researchers analyzed blood levels of five factors known toeither stimulate or inhibit angiogenesis. The only one showing a significantdifference among the groups was TGF-...

Review identifies factors leading to better outcome for some metastatic breast cancer patients

...from 1987 to 1995, was notspecifically designed to identify factors related to better response orsurvival, but the information was there for the looking, Rizzieri said. Early results of this trial, published in 1996 with an average of 20 months offollow-up, showed that for patients who got immediate high dose...

Novel neural net recognizes spoken words better than human listeners

...se levels, the likelihoodthat a human listener can identify spoken test words is mere chance. Bycontrast, Ber...mulus.With just a minor adjustment, the system can identify different speakers of thesame word with superhuman acuity. Berger and system co-designer Jim-Shih Li...

Female-specific genetic factors that contribute to emotional behaviors

...s using laboratory animals will help scientists to identify genesthat influence (in interaction with the environment) emotional reactionspossibly related to anxiety. The authors have identified, through this approach, a region on rat's chromosome 4 containing gene(s) strongly affecting a behavior thought to r...

Annals of Internal Medicine tip sheet - October 5, 1999

... and a simple questionnaire is an excellent way to identify patients atrisk (Editorial, p. 535.) * * * Remission of Rheumatoid Arthritis Reported after Stem-Cell Transplant from Twin A man with severe adult-onset rheumatoid arthritis received high-dosechemotherapy followed by stem-cell transplantation...

Researchers discover potential new approach to treating cystic fibrosis

...withcystic fibrosis and has also begun research to identify potential small-moleculedrugs to treat the disease under a grant from the Cystic Fibrosis Foundation. Genzyme expects to conduct its clinical trials of a DHA-based product incollaboration with the foundation, which has established a specialized netwo...

Scientist show how viruses co-opt cell defenses to cause chronic infections likethose from HIV and Hepatitis B and C

... the first example. A screen could be developed to identify naturally occurring antiviral agents.The system would identify virus-infected cells by the presence of activated PKRinside the cells. A drug that activates PKR co...

UI-led study indicates surgery is the best treatment for severe Bell's palsy paralysis

...sy. Theresearchers wanted to determine how to best identify which patients will be leftwith poor outcomes, est.... "But we demonstrated that electrical testing can identify a smallsubgroup that will have residual facial dysfunction, and surgical decompressioneliminated poo...

Pathway may provide target for treating chronic pain

...sociate inanesthesiology, reported that they could identify silent synapses by monitoringelectrical responses of individual neurons. After these synapses were awakened,they remained active and able to relay painful sensory information to the braineven after the painful stimulus was gone. In those experiments...

New tests for blood clots, lung cancer use NIDCR patented technology

..., and those who would normally require a biopsy to identify a lung tumoras benign or malignant. "Dr. Robey's peptide technology unquestionably speeded up thediscovery and development process for our diagnostic kits," said Dr. RichardDean, CEO of Diatide. If we had relied on traditional chem...

Federal institutes and the Robert Wood Johnson Foundation create Tobacco Use Research Centers

...nvestigator: David B. Abrams, Ph.D. Theme: identify early childhood and lifetime psychiatric factors t...estigator: Frances M. Leslie, Ph.D. Theme: identify predictors of nicotine addiction in animals and tobaccosusceptibility and use in humans using a shar...

Nanomolecular 'smart bombs' seek and destroy cancer cells

...edical School. "Now we need todevelop new ways to identify and treat these changes at the molecular level longbefore they can be detected with current technology. Research funded by thisNational Cancer Institute program could help bring us closer to that goal." Synthetic polymers called dendrimers will be u...

Physicians who compassionately ask about domestic violence can elicit positiveoutcomes, UCSF study shows

... The study looked at techniques physicians used to identify victims of domesticviolence. It found that compassionate asking--not necessarily getting a yes orno answer immediately--can help domestic violence victims find a way out oftheir situations. "A yes response from a patient should not be the goal of th...

1 2 3 4 5 6 7 8 9 10

(Date:11/23/2014)... BambooFlooringChina.com , the world’s leader in bamboo flooring, ... flooring collection. Now, the business is announcing big discounts ... promotion is valid until Dec. 20, 2014. , The new ... dust-free surface, which makes it very easy to maintain. As ... wants to make its website the best shopping platform for ...
(Date:11/22/2014)... (PRWEB) November 23, 2014 Cancer researchers ... a connection between intercellular communication tunnels and the growth ... the full story on the Surviving Mesothelioma website. ... and the University of Minnesota have just released their ... information and materials between cells. They found that ...
(Date:11/22/2014)... Recently, Locks-Magnetic.com , one of the successful electrical ... locks for glass doors online. In addition, the company ... products. Customers can get more information on its website. ... excellent performance. Customers who want to buy this new ... They also can enjoy the one-stop shopping experience. ...
(Date:11/22/2014)... PA (PRWEB) November 22, 2014 “Due to ... said an inventor, from Gurnee, Ill. “While using the ice ... be and I thought there needed to be a safer ... invented the SPIKE BLOCK. , The SPIKE BLOCK offers added ... so, it would help to reduce injuries and damage associated ...
(Date:11/22/2014)... PA (PRWEB) November 22, 2014 "My ... the pain caused by the machine," said an inventor ... she had to go back a second time because ... invention idea." , She developed the patent-pending MAMO EASY ... breast cancer. The design saves the patient from the ...
Breaking Medicine News(10 mins):Health News:Click Strand Woven Bamboo Flooring From Famous Bamboo Flooring Company BambooFlooringChina.com 2Health News:Study Links Cellular ‘Tunnels’ to Mesothelioma Proliferation, According to Surviving Mesothelioma 2Health News:Discounted Mag Locks for Glass Doors Revealed by Locks-Magnetic.com 2
Other Tags
bloomduecorpsesmellyvalvesimplifyarisingschrenkinsurancecirrhosiscelecoxibtooculpritfindresearchersstanford