Tag: "improve" at medical news

New guideline: Corticosteroids recommended for duchenne muscular dystrophy

...port devices, and corrective orthopedic surgery to improve the ability to function. Complete guidelines, a summary for physicians, and a version for patients and their families will be available on January 11 at www.aan.com/professionals/practice/guideline/index.cfm . ...

Health report-card fears make doctors forgo potential life-saving heart treatment

...cardiologists with low volumes or poor outcomes to improve their performance or stop performing the procedure. However, researchers say the unintended effects of the scorecard system on patient care decisions, as described in the paper, may adversely affect outcomes for patients who might benefit from angiop...

Entrepreneurism Center at UC San Diego funds commercialization of lung, shock, other devices

...inflammatory mediators in a rodent model of shock, improve blood pressure and survival. John West, Professor "Handheld Self-Contained Alveolar Gas Analyzer for Investigating Lung Disease" $38,000 Measuring oxygen and carbon dioxide in the depths of the lung so-called alveolar gas typically requires cum...

Orqis receives FDA approval to expand clinical trial of Cancion CRS therapy to 40 centers

...of abnormal aortic flow, induce vasodilatation and improve renal blood flow. Studies will also focus on hemodynamic improvement, reduced ventricular and atrial volumes and improved renal function, as well as whether the CRS therapy may have a sustained effect after removal, offering hope for potential thera...

Potential cure for lymphoma in HIV patients

... to help reduce these opportunistic infections and improve immunodeficiency, however, only nine Patients were able to tolerate this treatment for the entire study due to side effects such as nausea and inflammation of the mouth lining. The majority of Patients, though, did resume the HAART therapy soon after...

A biomarker to predict osteoarthritis

...e clearly seen and measured on an X-ray image-will improve outcomes. The need for better ways to assess OA's activity from its onset has led researchers to investigate possible biomarkers, particularly those related to cartilage and bone turnover. A biomarker is substance found in the blood or joint fluid...

The sustained benefits of very early treatment of rheumatoid arthritis with anti-TNF-alpha therapy

... therapy with methotrexate. DMARDs are drugs that improve the signs and symptoms of RA and reduce damage as shown by joint X-rays All twenty RA patients adhered to their assigned treatment for a full year. To closely monitor the impact of anti-TFN-alpha therapy on synovitis, the inflammation of the membran...

Simple sputum test for confirmation of childhood tuberculosis

... in the HIV-infected infant and child will greatly improve the ability of health-care staff to provide appropriate treatment and avoid the inappropriate use of antibiotics. This situation is not a pipe dream when we consider the available resources for tuberculosis and HIV research and the current efforts in...

More precise radiation therapy lets prostate cancer patients avoid erectile dysfunction

...ers suspect avoiding radiation to these areas will improve other quality of life issues, such as urinary leakage and bowel problems. In addition to McLaughlin, U-M study authors were Vrinda Narayana, Ph.D., adjunct clinical assistant professor of Radiation Oncology; Amichay Meriowitz, M.D., Sara Troyer, Pete...

Doctors must consider potentially inappropriate medications when treating elderly

... the ill effects of these drugs on the elderly and improve their care....

Most alcohol-related plane crashes occur at night and in worsening weather conditions

...nt weather conditions and develop test programs to improve aviation safety, such as routine spot checks, or checking on drinking behavior during pilots' biannual physical exams, that might help reduce alcohol-related crashes in the future. Current federal regulations do not allow any person to operate any ai...

Mayo Clinic Cancer Center receives SPORE grant for brain cancer research from NCI

...otential to reduce cancer incidence and mortality, improve survival, and enhance patients' quality of life. Laboratory and clinical scientists work collaboratively to plan, design and implement research programs focused on cancer prevention and control, early detection, diagnosis, treatment and survival....

Workers with carpal tunnel find relief with night-time splinting

...em, show that night-time splinting can effectively improve hand and wrist discomfort for active workers with early symptoms of carpal tunnel syndrome. The results from the study are published in the January issue of the Archives of Physical Medicine and Rehabilitation. While carpal tunnel syndrome is a com...

Scents and emotions linked by learning, Brown study shows

...ositive association with consumers. "Using odor to improve mood has industrial applications," she said. "Scent could even be used in schools or hospitals to improve performance or speed recovery." Herz conducted the experiments with the assistance of Sophia Beland,...

Study finds that adherence to diet, not type of diet, more important factor for losing weight

...e urgently needed," the authors write. "One way to improve dietary adherence rates in clinical practice may be to use a broad spectrum of diet options, to better match individual patient food preferences, lifestyles, and cardiovascular risk profiles. Participants in our study were not allowed to choose their...

New findings on patient safety at children's hospitals

...en's hospitals have joined in the national push to improve patient safety and avoid preventable problems. But...aborative team is working with AHRQ to continue to improve the indicators for children." In addition to Sedman, the research team included J. Mitchell Harris, ...

American Thoracic Society journal news tips for January 2005 (first issue)

...an opportunity to change the treatment strategy to improve outcome. The study appears in the first issue for January 2005 of the American Thoracic Society's peer-reviewed American Journal of Respiratory and Critical Care Medicine. ...

NIH action plan charts future challenges for liver disease research

...scarring and destruction of liver structure) would improve management of liver disease and facilitate clinica...tic techniques could detect liver cancer early and improve patient survival. Developing standardized and objective diagnostic criteria of major liver diseas...

Treating individuals: How generalisable are trial data?

... for secondary schools is to be applaudedUnless we improve our teaching, understanding, application, and communication of evidence, we risk denying patients the potential benefits derived from their peers who participated in research and of those who worked so hard to report and publish it."...

BMJ turns missing murder case documents over to FDA

...r drug saying, "Prozac has helped to significantly improve millions of lives. It is one of the most studied drugs in the history of medicine, and has been prescribed for more than 50 million people worldwide. The safety and efficiency of Prozac is well studied, well documented, and well established."...

1 2 3 4 5 6 7 8 9 10

(Date:4/18/2014)... scientists could lead to potential new treatments for breaking ... , Fibrosis, or scarring, is a hallmark of ... lungs can lead to serious organ damage and, in ... options centers on findings made by Swati Bhattacharyya, PhD, ... that a specific protein plays in promoting fibrosis. ...
(Date:4/17/2014)... popular vaccine brands for children may not be the ... cost factors when choosing vaccines, driving the market toward ... a new study by University of Illinois researchers. , ... by numerous factors," says Sheldon H. Jacobson, a co-author ... and of mathematics at the U. of I. "In ...
(Date:4/17/2014)... NY In a review published in the April ... president of The Feinstein Institute for Medical Research, says ... medical community,s approach to treating sepsis, which ... Americans. , Sepsis occurs when molecules released into the ... throughout the body. Inflammation is necessary for maintaining good ...
(Date:4/17/2014)... many as 10 million older Americans suffer from depression, ... , However, new research a project that followed ... six years found that Internet use among the ... than 30 percent. , "That,s a very strong effect," ... telecommunication, information studies and media who led the project. ...
(Date:4/17/2014)... 17, 2014 EcoHealth Alliance, a nonprofit organization that ... a comprehensive review today examining the current state of ... review calls for improved global surveillance strategies to combat ... outbreak of Ebola in West Africa that has claimed ... Guinea and Liberia. According to the World Health ...
Breaking Medicine News(10 mins):Health News:New clues on tissue scarring in scleroderma 2Health News:Study recalculates costs of combination vaccines 2Health News:Feinstein Institute researcher publishes new perspective on sepsis 2Health News:Internet use can help ward off depression among elderly 2Health News:Re-emergence of Ebola focuses need for global surveillance strategies 2Health News:Re-emergence of Ebola focuses need for global surveillance strategies 3
Other Tags
pandoraswettergrasslandsleftieshygieniccapacitiesmusculaturemirnasawaresummitkyotoesabrachytherapyinversetemporarilysue