Tag: "industrial" at medical news

Other highlights in the November 5 issue of JNCI

... Factory workers who are routinely exposed to the industrial chemical formaldehyde may have an increased risk of leukemia and lung cancer, according to two large studies that followed U.S. and British factory workers for an extended period of time. Formaldehyde is used extensively in the production of common...

Effective Clinical Practice, Nov/Dec 2000 highlights

...dical error definitions with those used to analyze industrial and transportation accidents, say medical errors should be defined in terms of failed processes that are clearly linked to adverse outcomes. Efforts to reduce errors should relate to the errors impact on outcomes (What is an Error?, p. 261). De...

North Carolina researcher receives award for new ant-HIV drug that simplifies treatment regime

...Administration approved in late 1998. Through its industrial innovation awards program, the American Chemical Society recognizes individuals and teams whose discoveries and inventions contribute to the commercial success of their companies and enhance the quality of life....

Chemical societies of Pacific rim nations

...ts of the pacific rim countries, thereby fostering industrial development, improving local and global environments, and the material well-being of their societies....

Connecticut researchers receive national award

...roes of Chemistry program, started in 1996, honors industrial chemists and chemical engineers who create commercially successful products that improve the quality of life....

Pacific Northwest National Laboratory wins three R&D 100 awards

...e product quality and equipment integrity in other industrial situations where measurements are difficult to obtain, such as detecting pipe leaks or monitoring rotating machinery. A radiation dose measurement system that is low cost, versatile and precise - Recent government approval of irradiation to kill...

AAPS Workshop to Examine Chemistry and Manufacturing Controls Trials, Emerging Products

...time to regulators from Europe and the U.S. and to industrial scientists from the innovator and generic companies." The workshop will bring together pharmaceutical scientists and regulators from the U.S. and Europe to discuss factors that have resulted in successful drug product registrations from the perspect...

New study finds multiple myeloma linked to radiation exposures of nuclear workers

... and chemical agents came from personnel, medical, industrial hygiene and health physics records, including readings from radiation badges known as dosimeters. The study included workers who died through 1990 or, among Hanford emp loyees, through 1986. Male workers and those hired before 1948 died of multiple ...

Nanostructures for drug delivery

...y's tissue. Giannelis' idea was to take a very old industrial idea, using inorganic particles, such as talc, as filler, but reducing the material almost to molecular scale to create what he calls "nanofillers." To do this, he took advantage of the natural structure of silicates, which under a microscope have a ...

Eastman gives Clemson University $38 million fiber technology

...gricultural, home care, sports, military and other industrial uses. "Eastman's extraordinary gift brings us one...n the home faucet to massive air filters needed in industrial processes. No other graduate students in the country have access to this technology at this depth. ...

Scientific societies honor creation of the Mexican steroid hormone industry

...sylvania, logró la primer conversión industrial de diosgenina (aislada de una especie mexicana de ...er el precursor preferido en la preparación industrial de cortisona, la hormona anti-inflamatoria. En 1951 los investigadores de Syntex sintetizaron el pr...

Hostility, coercion, sexism among causes of harassment in military

...rasgow, a professor of psychology and of labor and industrial relations and guest editor of the journal's special issue on sexual harassment. "Basically, what we found is that tolerant attitudes by leaders in an organization are related to increased rates of harassment, and that sexual harassment has real nega...

Material that made car bumpers shine finds a role in manufacture of drugs, dyes

...he screening of thecompounds for a wide variety of industrial products, says Miller. The Rochester chemists have shown how chromium chloride can be used toenergize a rare solid-to-solid catalytic reaction that makes it possible toproduce a huge variety of anilines simultaneously. Chromium chloride shutt...

Lack of sleep alters hormones, metabolism

...ely common response to the time pressures ofmodern industrial societies. The average night's sleep decreased from aboutnine hours in 1910 to about 7.5 hours in 1975, a trend that continues. Millionsof shift workers average less than five hours per work day. Previous studies,however, have measured only the co...

International study provides important benchmark for countries still using leaded gasoline

...ment as a result of exposure to lead. Exposures to industrial emissions, lead-soldered food cans and lead-based paintalso can contribute to elevated blood lead levels, says Thomas. However, shepoints out, "both the timing of the reductions, and data on air leadconcentrations, indicate that reductions of lead i...

Protein Power: 'Salt cloud' concept shows promise for developing new drugs and foods faster, at lower cost

...llet" type medicines, more nutritious foods andnew industrial enzymes might be made at lower cost, by using a molecular filterthat exploits the salt-cloud concept, says Prof. Andrew L. Zydney of UD'sDepartment of Chemical Engineering. The new technology, now in development, was disclosed Oct. 12 at theInternati...

Getting your teeth into superplastic forming

...arch team at King'sCollege in London, UK, using an industrial process called superplastic forming. These new prostheses will allow patients much greater comfort but could alsomean an end to problems associated with prosthesis fracture and wear. Superplastic forming, traditionally used by industry as an effectiv...

You have to break a few (hundred) eggs to make a good crystal

...somerase, a larger (46,000 Daltons) protein usedin industrial processes to convert glucose to a sweeter sugar called fructose. "In all of the proteins we're using the structure is pretty well known," Judgeadded. In addition to ground-based experiments, Judge hopes to conduct flightexperiments in the next year o...

New HIV drug intervention cheap and effective

... most effective way to prevent HIV transmission in industrial countries like the United States, it is expensive and must be started early in pregnancy. Most African mothers cannot afford AZT and often do not get prenatal care, thereby missing their chance to begin treatment. To address the needs of developing ...

MRI for carpets & fabrics: Researchers apply medical diagnostic tool to wide range of industrial processes

...logy areapplying the technique to a broad range of industrial processes,using MRI to watch carpet dry from the i... as a function of time during conditionssimulating industrial drying processes. They've also seen howsurface fluorocarbon finishes affect the way water penetrate...

1 2 3 4 5 6 7 8

(Date:8/22/2014)... (PRWEB) August 22, 2014 A new, online ... connection. The summit is no-cost and open to everyone. ... kept secrets, practical tips and advice on how to stop ... or manage weight. Mindful eating is not a diet. ... stay motivated instead of an "eat this, don't eat that" ...
(Date:8/22/2014)... who need surgery for facial pain caused by trigeminal ... used, reports a study in the September issue of ... Congress of Neurological Surgeons . The journal is ... part of Wolters Kluwer Health . , Percutaneous ... lower cost than other types of surgical treatments for ...
(Date:8/22/2014)... Ticket Down is a reliable source for ... Albuquerque and Rapid City. For fans looking to speak with ... allows just that. Caputo was born and raised in Hicksville, ... knit family who began to see spirits when she was ... had a chance to do what most people wished they ...
(Date:8/22/2014)... 2014 Pirate Jonny's Caribbean ... in providing new recipe cards, fun t-shirts, and caps ... Hailing from Clearwater, Florida, Pirate Jonny, aka, Jonathan Toner, ... with two to three recipes featuring different flavors of ... on the website. The recipe cards will feature ...
(Date:8/22/2014)... According to the new research ... Global Trends & Forecast to 2019" defines and ... forecast of the market value. The isocyanate material ... 2019, at a significant CAGR from 2014 to ... 44 figures spread through 286 pages and in-depth ...
Breaking Medicine News(10 mins):Health News:20 Top Experts Discuss How to Unravel the Food-Mood Connection 2Health News:More common procedures for painful facial tics carry high costs, reports study in Neurosurgery 2Health News:Theresa Caputo Tickets in Kalamazoo at Wings Stadium, Saenger Theatre in New Orleans, Kiva Auditorium in Albuquerque and Rapid City at Don Barnett Arena Now Available 2Health News:Pirate Jonny's Caribbean BBQ Rubs, Seasonings & Sauces Get New Look by Hoisting New Recipe Card Creations and New Clothing Apparel for its Logos 2Health News:Isocyanate Market An Industry Growing Steadily Projected to Grow $38,729 Million by 2019 - Report by MarketsandMarkets 2Health News:Isocyanate Market An Industry Growing Steadily Projected to Grow $38,729 Million by 2019 - Report by MarketsandMarkets 3Health News:Isocyanate Market An Industry Growing Steadily Projected to Grow $38,729 Million by 2019 - Report by MarketsandMarkets 4
Other Tags
circuitrythinkingmapsdeficitdyingdesertcardiometabolicdipregrowparametersmanagesscriptshandfulavertperversitydrills