Tag: "infection" at medical news

ACTG Protocol 185 Enrollment Halted

...e to a welcome but unexpectedly low rate of infant infection which made comparison of the standard and experime...ssion of HIV accounts for the vast majority of HIV infection in infants and children worldwide. As of December 1996, 7,629 cases of pediatric AIDS have been rep...

Guidelines Offer Ways To Curb Antibiotic-Resistant Infections

...” Hoffmann and co-author Irene Kittrell, an infection control practitioner at UNC Hospitals, identified nine health-care settings needing control measures. They are long-term care, home health, hospices, doctors' offices and outpatient clinics, schools for the physically and mentally challenged, rest ho...

The Condom Conundrum--How Are We Going To Teach Safe Behavior If Parents Are Afraid To Talk To Their Children About Sex?

...st interest. It is one way to keep the rate of HIV infection as low as possible," she argues. "The more condoms are used, the better it is for all of us." Why are condoms so important? "Because they are the most common method of birth control used by teens," says Morrison, "and virtually the only one they use...

TB Prophylaxis Unnecessary In HIV-Infected People With Anergy, Study Suggests

...risk for tuberculosis (TB) but without confirmedTB infection do not benefit from preventive treatment with a fr...s by focusing onHIV-infected persons with known TB infection or who have close contact withanother individual with active TB." Although only 10 percent of health...

Mother's Milk: Nutrition And Nurture For Infants -- And The Best Defense Against Disease

... compound containingantibodies that defend against infection and hormones and growth factors thatdirect the inf...desand glycoconjugates, in particular, may inhibit infection by binding topathogens at the molecular sites that they would otherwise use to attach to andthen att...

Stress: It's Not Just All In Your Head; Scientists Map The Wear And Tear Of Daily Life

...ssion of the immunesystem (which leaves us open to infection and infectious diseases), aswell as bone loss, muscular weakening, atherosclerosis and increased insulinlevels that cause higher levels of fat deposition in the body, especiallyaround the abdomen. "People end up with that 'apple' body shape that re...

Snipping Inflammation In The Bud; New Agents May Provide Relief

...Inflammation is the body's response to irritation, infection or injury. Itbegins at the level of the cell when, in response to an injury or irritation,white blood cells in the bloodstream begin to stick to the cells lining theblood vessel wall. The end result of this process is inflammation and pain. The cells...

Declining National Rates Of HIV-Related Deaths And Illnesses Due To Combination Antiretroviral Therapy With Protease Inhibitors

...hibitor. Death rates andincidence of opportunistic infection were compared by antiretroviral level,drugs prescribed to prevent opportunisitic infection, patient demographics (i.e., gender, age, ethnicity andmode of HIV acquisition), and CD4 cell count (a measure of drugs' efficacy) atfirst study visit, as well...

Need For HIV Guidelines For Health Workers In Developing Countries

(Reducing the risk of nosocomial HIV infection in British health workers working overseas: role o... examine the issue of the risk of occupational HIV infection from patient to health worker in the developing world. The authors note that the prevalence of HIV i...

Study Questions Common Practice Of Steroid Administration To Induce Lung Development In Premature Infants

...ated with dexamethasone at two weeks of age had an infection rate thatwas 50% higher than the infants who received placebo at two weeks of age. Moreover, both groups of infants gained weight more slowly and had slower headgrowth while they received dexamethasone. The authors questioned whethercurrent dexameth...

Antibiotic Prophylaxis Could Help Prevent Respiratory Infections in the Critically Ill

... of antibiotic prophylaxis to prevent this type of infection happening. The authors found that if the most effective antibiotic prophylaxis was used, the numbers of respiratory tract infections fell by over two thirds and overall mortality was reduced in critically ill patients. However, Liberati et al warn ...

Cost-Effective Treatment Possible In Africa For HIV-Positive Pregnant Women If Drug Prices Lowered

... among others--areHIV positive. The prevalence of infection among child-bearing-age women exceeds30 percent in...irth only. The cost of preventing one infant HIV infection in areas of 15 percentprevalence in pregnant women would range from $1,445 to $817 depending on whic...

Advisory: Nasal Spray Influenza Vaccine

...n moregood news for children. Otitis media, an ear infection common in children, can be an extremely painfulillness for children. It is also associated with fever, irritability, sleepdisturbances, anorexia and vomiting. Clinical trials funded by the vaccinemanufacturer, Aviron, recently determined that Maass...

Abstinence Reduces HIV For High-Risk Women - Even Those Who Relapse - Study Shows

... during the period, there would be prevention of 1 infection in infants,72 infections in adults, and $16 millio...limbed to 50%,there would still be prevention of 1 infection in infants, 66 infections inadults, and $11.8 million in savings. In contrast, a perfect success rat...

Crystal Structure Of gp120 Reveals HIV In Action

... can the membranes ofvirus and human cell fuse and infection proceed. Having the structure of gp120 complements and extends the fuzziersnapshots of the molecule from genetic studies. "We can use mutational analysisto say 'the CD4 binding site must be here.' But with X-ray crystallography, weactually se...

Educational Intervention Can Reduce Sexual Behaviors Known To Transmit HIV

...line interview. Nationwide, rates of HIV infection and AIDS are higher among racial andethnic minority populations, especially African Americas, who represented 41percent of new AIDS cases in 1996. Heterosexual transmission of HIV is risingrapidly, especially among ethnic minority women. In a...

Intervention can help reduce risky sexual behavior, according to results published in Science

...ear period. In the United States, rates of infection and AIDS are highest amongracial and ethnic minorities living in low-income, urban settings. So the NIMHMultisite HIV Prevention Trial recruited 3,700 such participants from 37 healthclinics at seven sites: the Bronx and Harlem; Manhattan, Brooklyn, ...

Landmark Study Shows Behavioral Interventions Reduce HIV-Related Sexual Risk Behavior

...wereat high behavioral risk for HIV. Rates of HIV infection and AIDS are higheramong racial and ethnic minority populations, especially African Americans, who represented45% of new AIDS cases in 1997. Heterosexual transmission is rising rapidly,especially among ethnic minority women. The Clinton Administrat...

Thousands Of AIDS Deaths Could Be Prevented With Expanded Medicaid Coverage, UCSF Study Concludes

...ected to be HIV positive and inthe early stages of infection and one-third to have AIDS. The analysis took into account the savings that would occur in other federal andincome support programs, such as the AIDS Drug Assistance Program that providesmedications to persons who do not have access through other mea...

UCSF Researchers Seeing Increased Rates Of Unprotected Sex Among San Francisco Gay Men

... HIV during the five-yearcourse of the study. The infection rate in 1994 was 2.6 percent, but the ratehas been...d may be lessinfectious than those untreated. The infection rate has been declining in SanFrancisco and the men in the study are possibly less likely to encount...

1 2 3 4 5 6 7 8 9 10

(Date:5/22/2013)... 22, 2013 Cedars-Sinai Heart Institute is honoring ... pioneer in modern mitral heart valve repair, Alain ... Corday, MD, International Prize in Heart Research. The ... recognize physicians and scientists conducting groundbreaking research, or ... medicine. , Carpentier is a leading ...
(Date:5/22/2013)... A new study provides neurobiological evidence for ... in people with insomnia, which may have implications ... , "Insomnia has been consistently identified as a ... Franzen, PhD, an assistant professor of psychiatry at ... in the brain circuitry underlying emotion regulation may ...
(Date:5/22/2013)... May 22, 2013 Digital Advertising Agency, ... behalf of its social media management client, Primal ... year's supply of the all-natural organic deodorant. The contest ... of the rapidly-growing start-up deodorant company based in Tampa, ... contest or sweepstakes on a Facebook page is a ...
(Date:5/22/2013)... (PRWEB) May 22, 2013 DiscountFurnaceFilter.com ... quality merchandise ranging from furnace filters, dehumidifiers, fans, ... is excited to add Stadler Form's product line ... summer product line (fans, aroma diffusers and dehumidifiers) ... Form’s Otto Fan is the perfect combination of ...
(Date:5/22/2013)... York, NY and Troy, NY (PRWEB) May 22, ... Medicine at Mount Sinai and Rensselaer Polytechnic Institute ... educational programs, research, and development of new diagnostic ... alliance was commemorated in a signing ceremony on ... initiative to use their expertise—Rensselaer’s in engineering and ...
Breaking Medicine News(10 mins):Health News:Heart valve repair innovator receives Cedars-Sinai Heart Institute's Corday Prize in Heart Research 2Health News:Study shows that insomnia may cause dysfunction in emotional brain circuitry 2Health News:Social Media Management Firm, 21Digital, Launches National Facebook Sweepstakes for Client, Primal Pit Paste 2Health News:DiscountFurnaceFilter.com Now Offers Stadler Form Products - Providing Solutions to All Your Summer Needs 2Health News:Icahn School of Medicine at Mount Sinai and Rensselaer Polytechnic Institute Announce Academic Collaboration 2Health News:Icahn School of Medicine at Mount Sinai and Rensselaer Polytechnic Institute Announce Academic Collaboration 3Health News:Icahn School of Medicine at Mount Sinai and Rensselaer Polytechnic Institute Announce Academic Collaboration 4Health News:Icahn School of Medicine at Mount Sinai and Rensselaer Polytechnic Institute Announce Academic Collaboration 5Health News:Icahn School of Medicine at Mount Sinai and Rensselaer Polytechnic Institute Announce Academic Collaboration 6Health News:Icahn School of Medicine at Mount Sinai and Rensselaer Polytechnic Institute Announce Academic Collaboration 7
Other Tags
deficitmammarymissilesguidedcoloradoinfluencesculturealoneopensdocumentedruinousmethamphtetamineflycheckfacedmetacognition