Tag: "interplay" at medical news

Promising new strategy for Swedish medical research

...w possibilities for a greater understanding of the interplay between heredity, lifestyle and the environment as regards our most common diseases. In the wake of the HUGO project, we now have an opportunity to develop completely new tools for prevention and early diagnosis. "LifeGene" takes a global perspective...

NCI scientists create model that predicts follicular lymphoma survival

...tures came from immune cells suggests an important interplay between the host immune system and malignant cells in follicular lymphoma. "One possibility is that the immune cells with the good-prognosis signature are attacking the lymphoma and keeping it in check," Staudt speculated. "Another possibility is t...

Chemoprevention backgrounder: Working for a future of cancer chemoprevention

...nates at the site of chronic inflammation, and the interplay between the two is being increasingly studied. Lippman ticks off on his fingers the role that inflammation plays in "heart disease, Alzheimer's disease, the chronic diseases associated with aging, and even obesity," and says that NSAIDs and statins, ...

Oats not safe for all patients with celiac disease

...ry diseases, celiac disease is caused by a complex interplay between genetic and environmental factors, but it is better understood than most. Long believed to be a relatively rare disorder, it is now thought to affect about one in 250 people worldwide. Clinical symptoms are present in less than half of patien...

UCI's Brain Imaging Center chosen to help advance nation's Roadmap for Medical Research

... of mental illness, individual differences and the interplay between genetics, environment and brain function. NCI exploratory centers support novel interdisciplinary research strategies to solve significant biomedical problems. If successful, these centers can receive further funding for the development of an...

New global trials help to make FOSRENOL(R) the most extensively studied modern phosphate binder

...dangerous consequences as it disrupts the delicate interplay between the body's levels of calcium, parathyroid hormone and vitamin D, resulting in calcium deposits in the vasculature, which contribute to cardiovascular disease, and renal bone disease, which may give rise to skeletal deformities, pain and fract...

Are toddlers who can't sleep at higher risk of becoming teens who smoke, drink or do drugs?

...y professor Kirk Brower, M.D., who has studied the interplay of alcohol and sleep in adults, and is Executive Director of the Chelsea Arbor Treatment Center, which treats teen and adult substance abusers. (Chelsea Arbor is a joint program of U-M and Chelsea Community Hospital.) "Our finding sees early chil...

Age-related muscle loss linked to protein interplay, says Stanford researcher

...after injury, Rando said similar problems with the interplay between Delta and Notch may cause the gradual muscle atrophy that occurs in older people, in astronauts or in people whose limbs are immobilized in a cast or from bed rest. "If you presume that normal muscle bulk is maintained by gradual replacement ...

Fosrenol shows significant reduction in serum phosphate in Chinese end-stage kidney disease patients

...sphatemia. Hyperphosphatemia disrupts the delicate interplay between the body's levels of calcium, parathyroid hormone (PTH) and vitamin D. Over time, hyperphosphatemia can ultimately lead to calcification of the heart, lung and some arteries. Accumulating evidence shows that hyperphosphatemia contributes to...

ACP publishes 'Medical Meanings,' second edition

...who savors the romance of language and the fertile interplay of thought, word, and deed." (JAMA) Dr. Haubrich is a clinical professor of medicine at the University of California at San Diego and senior consultant emeritus at the Scripps Clinic, La Jolla. He is the author or co-author of more than 130 original ...

Cancer patients find more pain relief when treatment guidelines are followed

...udy. Using a mathematical model that describes the interplay of clinical decisions and economics, the researchers found that guideline-based cancer pain management offered effective pain relief in 80 percent of patients compared to 30 percent effectiveness for the "as needed" pain management by non-specialty p...

UCSF & SF Bay Area receive federal funds to expand breast cancer / environmental research

...havioral exposures in young girls; and observe the interplay between genetics and these exposures. In addition, community advocate Barlow, of Marin Breast Cancer Watch, will lead an outreach project that disseminates information about breast cancer and the environment to the public. Maintaining a dialogue be...

New study of obesity, genes and socio-economic status uses individual growth curves

...hose from lower SES levels. with respect to the interplay of obesity and family history of cardiovascular disease, skinfold thickness and waist circumference increased more rapidly in children with a family history of heart attacks. children from families with a history of hypertension showed higher lev...

Alcohol-damaged brains 'recruit' new brain regions to perform simple tasks

...e muscles of the hand, that is then coordinated by interplay between the cerebellum and the frontal lobes. In other words, I reasoned that there would probably be abnormalities in activation of these regions in alcoholics during finger tapping." While undergoing MRI, two groups of participants performed repe...

'Prehabilitation' prevents functional decline of at-risk frail elders living at home

...ly people is complex and is thought to involve the interplay of impairments in physical ability, cognitive status, and intervening events. The "prehabilitation" intervention's cost of $2,000 per person was moderate compared with cost of other treatments; further evaluation is needed to determine the program's...

Scientists become filmmakers to decipher immunity

...develop." Much of our current understanding of the interplay among immune cells and their targets has been inferred from looking at chemically stained cells in thin slices of tissues observed under a microscope. Video microscopy has been used to observe the movement of cells, but its use has been limited to s...

Solving the COX conundrum

...y importance of this observation by clarifying the interplay of the two COX products in the cardiovascular system." FitzGerald observed almost twenty years ago that formation of both thromboxane and prostacyclin is increased in patients with heart and blood vessel disease who benefit from aspirin. Given their...

Researchers gain insights on pulmonary fibrosis

...use of pulmonary fibrosis will likely be a complex interplay between susceptibility genes and environmental factors, such as inhaled agents or dusts. While the researchers have yet to pinpoint a gene or genes for the disease, they say the key to unlocking the cause or causes will come from sophisticated analys...

Highest known catalytic rate for superoxide dismutation achieved

...ions. Once we understood the subtle and unobvious interplay between position, number and spatial arrangement of atoms and groups in dictating a molecules catalytic activity, we were able to design highly complicated molecules and test their potential as catalysts, explained Riley. Thus, we are now able to ...

Duke orthopedic surgeon bucks conventional wisdom; develops surgical approach for broken collarbones

...aining its strength and flexibility from a complex interplay of muscles, tendons and ligaments. Only primates, humans and birds have clavicles. Because of its position and its relative thinness, the clavicle is also one of the most frequentlybroken bones in the body. It is estimated that about 15 percent of ...

1 2

(Date:12/20/2014)... 20, 2014 Parker & Sons, Inc. ... years of experience in contractor services announces reaching a ... for the homeowners of Arizona. Parker and Sons is ... contractor technicians that make customer service the number one ... Arizona and started with one service vehicle and has ...
(Date:12/19/2014)... (PRWEB) December 19, 2014 Sub Zero Ice ... sponsor a blood drive Sunday the 28th from 2pm-6pm at ... & Sawyer Road in Sarasota, FL. , Inquiries regarding time ... you for participating in the donating process, Sub Zero Ice ... flash frozen, custom ice cream. , About Sub Zero Ice ...
(Date:12/19/2014)... 2014 Eufaula, Oklahoma, located just 9 ... the state’s largest lake with more than 600 miles ... to a little more than 3,000 residents, hosted its ... the 6th of December. , Featuring Santa, Christmas lights ... Eufaula on Main Street. Narconon Arrowhead’s parade float ...
(Date:12/19/2014)... warns parents that buying an older car for their teens may ... drivers killed in the United States between 2008 and 2012 were ... lacked important safety features that are available on newer cars, the ... were in cars at least six years old, 34 percent were ... cars 11 to 15 years old, and 17 percent were in ...
(Date:12/19/2014)... 2014 (HealthDay News) -- Dense bunches of bacteria called biofilms ... new study finds. The researchers said these biofilms ... The presence of these biofilms may represent an increased ... to predict a person,s risk for the disease, the researchers ... these biofilms may coat the mucus layer of cells lining ...
Breaking Medicine News(10 mins):Health News:Parker & Sons Announces Reaching A Milestone By Providing 40 Years Of Dedicated Contractor Services For Homeowners Of Arizona 2Health News:Parker & Sons Announces Reaching A Milestone By Providing 40 Years Of Dedicated Contractor Services For Homeowners Of Arizona 3Health News:Shark Tank’s Sub Zero Ice Cream Sponsors Blood Drive 2Health News:Narconon Arrowhead Debuts Float at Checotah and Eufaula Christmas Parades 2Health News:Narconon Arrowhead Debuts Float at Checotah and Eufaula Christmas Parades 3Health News:Older Cars a Bad Choice for Younger Drivers 2Health News:Could Bacteria Play a Role in Colon Cancer? 2
Other Tags
interfacebalancelonglinecasualtiesadversarycommerciallymirrorcletarcevashuntsalertssilenceamplifymetalsthinksvolunteersfully