Tag: "lack" at medical news

Study shows promise in identifying kidney failure

... rarely administered in a timely manner due to the lack of early biomarkers of kidney failure," Dr. Devarajan said. The Lancet study used as its model children undergoing cardiopulmonary bypass surgery, 10-40 percent of these children will experience kidney failure. Earlier studies in animal models by Dr....

Physicians may not be accurate in their confidence levels of their diagnoses, says Pitt study

...s were not aligned, physicians were more likely to lack confidence in a correct diagnosis than the reverse." Nonetheless, he added, residents and more experienced internists were "overconfident," believing they are correct when in fact they were not, in 12 to 15 percent of the cases overall. "Overconfiden...

Lack of clinical trial participation may contribute to lower survival rates

...ith some cancers may be partially explained by the lack of participation in clinical trials. The study, pu...in leukemias, brain tumors, and cancer in general, lack of clinical trial participation (and of the increased knowledge of tumor biology that derives from m...

Professionalism and professional ethics in medicine

...tient communication about out-of-pocket costs were lack of habit, insufficient time and concern over patient discomfort. "Despite barriers, physicians use multiple strategies that may vary in efficacy to assist patients burdened by these costs," the authors write. The most common strategies were switching...

Extreme exertion, emotion can spark repeat heart attacks

...ase over the long term, such as cigarette smoking, lack of exercise, work stress, social isolation, anxiety and depression. The review notes that "physical exertion has an apparently paradoxic association with triggering" severe chest pain, heart attack or sudden death. Physically fit people enjoy a reduc...

Targeting mutant B-Raf protein reduces melanoma development

...will be one in 50 by 2010. As a direct result of a lack of effective therapeutics, the 2005 prognosis for patients in the metastatic stages of the disease remains very poor with average survival ranging from six to 10 months. In addition to Robertson, the study team included: Arati Sharma, Nishit R. Trive...

Recovered king of beasts returns to his home, thanks to unique operation

...mal died due to the disease, either because of the lack of proper medical treatment or because of imprecise diagnosis. In most of the cases, the nature of the problem was revealed with certainty only after death. "We decided to carry out this operation that had never before been performed anywhere," said...

Use of inhaled corticosteroid led to fewer hospitalizations for young children with asthma

... the case, although one potential indicator is the lack of awareness and education about childhood asthma. Asthma is the third leading cause of hospitalization among children under the age of 15, and it is the most common chronic medical condition. 4 Approximately 6.3 million children under 18 years of ...

Pushy parents can be bad for their children's health

...ficant degree of family conflict/dysfunction and a lack of insight into the consequences of parental behav...angers of 'healthcare consumerism' in families who lack insight into the derivation of their children's symptoms. "Robust systems are needed to protect the...

College alcohol problems exceed previous estimates

...omicide, suicide, and any other kind of injury, we lack the most dependable yardstick by which to measure the magnitude of alcohol-related fatal injuries among college students, and whether this figure is changing over time." The researchers conclude that greater enforcement of the legal drinking age of 2...

Disfigured patients may be forced to forego surgery

... companies have denied coverage, it was based on a lack of medical necessity; however, patients could appeal the denial and with proper scientific literature and evidence-based studies the denial could be overturned. The new exclusion tactic simply eliminates coverage of specific procedures due to contrac...

Cardiologists underestimate racial and ethnic disparities in care

...ies involved the health care system (insurance and lack of time) and the patients themselves (failure to a...information, they were disappointed by the general lack of awareness of disparities. Several organizations have been spotlighting this issue. A report fro...

Blacks less likely to get expensive, newer heart treatments

...ty Research and Promotion. Cardiac ischemia is the lack of blood flow and oxygen to the heart. "Non-ST-elevation" acute coronary syndromes occur when there are no classic electrocardiogram changes present yet the heart is still not receiving enough oxygen. American Heart Association and American College...

Cardiovascular health disparities must be eradicated

... system. The report concluded that the system may lack cultural sensitivity, may include communication barriers for non-English-speaking patients, or is too difficult to access due to insurance and/or financial limitations. "Significant cultural diversity exists in this country and cultural awareness, mo...

Vitamin E may not prevent cancer or cardiovascular events, but may increase risk for heart failure

...is strongly recommended." "In conjunction with its lack of efficacy, the potential for harm suggested by our findings strongly supports the view that vitamin E supplements should not be used in patients with vascular disease or diabetes mellitus," the authors write. "Our study also has wider implications....

Community care tops medical care at preventing heart disease in black Americans

...es, such as limited access to medical services, or lack of affordable medications, educational resources and culturally appropriate health care, are the root of the racial disparities in health status in the United States. For one year, the researchers analyzed how well patients followed their physicians'...

Effects of education level on rates of obesity differ by race

...ainment in the same way that white women do." "The lack of an observable benefit on BMI for educated African-American women is particularly alarming given their disproportionately high rates of obesity and obesity-related illnesses," the authors conclude. "Because race-education patterns appear to be well...

Medicaid enrollment at late stages may partly explain poor outcomes for cancer

...there is little research to explain the surprising lack of survival differences between Medicaid and uninsured patients. To further examine the contribution of Medicaid's policies in cancer outcome, Cathy Bradley, Ph.D. of Michigan State University and her colleagues reviewed the records of 13,740 subject...

Chemicals in tattoo inks need closer scrutiny

...tential health problems might be stemming from the lack of oversight, according to the researchers. There have been a variety of claims that tattoo inks cause adverse effects in people, including allergic reactions to ink components, a burning sensation during the course of MRIs, and the migration of inks...

Finances, not having a dentist are primary barriers to seniors receiving needed dental care

...arrier reported was cost. Respondents also named lack of dental insurance, anxiety about going to the de...because they had no natural teeth. Therefore, the lack of insurance was not perceived as a barrier for these people. "I think this difference is due to la...

1 2 3 4 5 6 7 8 9 10

(Date:4/17/2014)... PLOS Pathogens , children who live in regions of ... immune response to infection with malaria parasites that may ... and illness and partially control the growth of malaria ... develop future interventions that prevent or mitigate the disease ... 200 million cases of malaria occur worldwide, resulting in ...
(Date:4/17/2014)... Two recent papers by a University of Colorado ... scientists develop treatments or vaccines for Dengue fever, ... other disease-causing flaviviruses. , Jeffrey S. Kieft, PhD, ... the School of Medicine and an early career ... colleagues recently published articles in the scholarly journals ...
(Date:4/17/2014)... biology team has created a new technology for ... could travel the body and selectively target cancer ... biological devices that monitor and modify human physiology ... However, no existing technology enabled bioengineers to build ... and respond in a customized fashion. , "The ...
(Date:4/17/2014)... estimated that as many as 10 million older Americans ... loneliness and isolation. , However, new research a ... older Americans for six years found that Internet ... depression by more than 30 percent. , "That,s a ... University professor of telecommunication, information studies and media who ...
(Date:4/17/2014)... 17, 2014 By discovering a new mechanism that ... stroke, researchers at UC Irvine and the Salk Institute ... limit or prevent stroke-induced brain damage. , A complex ... of death and primary reason for disability in the ... stroke and lets blood-borne material into the brain, causing ...
Breaking Medicine News(10 mins):Health News:Study sheds light on how the immune system protects children from malaria 2Health News:CU researchers discover target for treating dengue fever 2Health News:Building 'smart' cell-based therapies 2Health News:Internet use can help ward off depression among elderly 2Health News:Study IDs new cause of brain bleeding immediately after stroke 2
Other Tags
architectsbeaverrunawaycaspaseclindamycinplentifulpertussisimmunogenicityallergenillnessessupplementsherbalprofessorshipbassetspaceddocument