Tag: "lifetime" at medical news

Dr. Brenda Milner first foreign associate of the NAS to receive Award in the Neurosciences

...ners amongst the previous recipients. Through her lifetime of research and teaching here at the MNI and McGill, Brenda Milner has had an extraordinary influence on the shape of neuroscience and on the lives of scientists around the world," said Dr. David Colman, Director of the MNI. "From her seminal work i...

Pediatricians and parents key to improving quality of children's health care

...ty in childhood could set a person up for a higher lifetime risk of cardiovascular disease and other chronic illnesses." Even when convincing evidence demonstrates that a medical practice results in better outcomes, practitioners often fall short of providing optimal care for children, Dr. Simpson said. For ...

U-M study: Doctors more likely to prescribe pricey new blood pressure drugs

...ients get more affordable medicine, but it's not a lifetime supply. After the free samples run out, the patient is left to pay for a more expensive drug," Ubel says. In addition to Ubel, study authors were Christopher Jepson, Ph.D., and David A. Asch, M.D., MBA, both from the University of Pennsylvania School...

Men do not cause yeast infections in women

..." Reed says. The woman's age at first intercourse, lifetime number of partners, frequency of intercourse or anal intercourse in the previous month were all not associated with recurrences. The researchers suggest that Candida exists in some women in balance with the other organisms and immune components in th...

When alcohol consumption evolves from a 'social lubricant' into a 'crutch'

...omas noted that although reports vary, the average lifetime prevalence of alcoholism among individuals with so...eir lifetime. This compares to about a 10 percent lifetime prevalence of alcoholism in the general population, or, one in 10. For this study, Thomas and her co...

Acclaimed Carnegie Mellon psychologist honored for groundbreaking research

... James McKeen Cattell Fellow Award for outstanding lifetime contributions to applied psychological research, will be honored for his work on the roles of psychological and social factors in health and well-being. He will receive the award in a ceremony in July at the American Psychological Association's annua...

'Sunshine vitamin' shines in colon study

...mors, due to the potential for side effects over a lifetime of anti-inflammatory consumption. Exercise, calcium, folic acid and multivitamins were shown in the study to be marginally beneficial in lowering risk. In looking at factors that increase the risk of colon cancer, the research poses yet another rea...

Re-examining alcohol problems among American Indian communities

...n both tribes than in the NCS sample, NP women had lifetime rates of DSM-III-R alcohol dependence twice that of NCS women; whereas SW women had rates very similar to those of NCS women. Both Spicer and Beauvais said these findings warrant further investigation. "Indian men are clearly accounting for the grea...

Rochester chosen to focus on rare neurological diseases

...es, that most doctors never see a single case in a lifetime of practice. Many patients go from doctor to doctor for years before receiving a correct diagnosis from a specialist such as Griggs, who is sought out by patients around the globe who have rare neuromuscular disorders. Griggs and colleague Rabi Tawi...

Newborn screening is cost-effective in detecting rare but treatable genetic disease

...archers computed the costs of hospitalizations and lifetime medical services for chronic disease. "We found the cost of newborn screening for MCADD to be well below the accepted costs for other health care interventions, such as acute newborn intensive care or newborn hearing screening," said Dr. Venditti. Th...

Mayo Clinic researchers discover how key cancer protein works

...t may trigger additional mutations throughout your lifetime and that contributes to a lifetime risk of developing breast cancer. We wanted to understand the molecular mechanism behind this," says...

Researcher at UCLA's Jonsson Cancer Center wins lifetime achievement award

...ic honor given by the society, lauds Witte for his lifetime achievement in cancer research and recognizes his significant contributions to understanding the cause of certain blood cancers and immune disorders -- findings that have led to the development of improved therapies for patients. Specifically, Witte'...

Working out may keep breast cells working well

...fication. Interviewers asked participants about lifetime involvement in activities such as walking, jogging, dance and swimming. The researchers came up with each woman's weekly average hours and average energy spent exercising since she began menstruating. When researchers adjusted for known breast cancer...

Stanford computer model shows bypass surgery more cost-effective than stents

...e trial, which was just 10 years long, through the lifetime of the patients." Even the researchers were surprised by their findings. "We expected stenting to be much better than bypass surgery," said Yock. But, she explained, surgery also has had technological advancements, becoming safer and more effective, ...

Heading into difficulty?

...at, "no significant or strong effect was found for lifetime heading on neuropsychological performance." But, h...osite conclusion, noting "players with the highest lifetime estimates of heading had poorer scores on scales measuring attention, concentration, cognitive flexi...

High blood pressure is a factor in some 'senior moments'

...are most likely to increase brain blood flow. The lifetime risk of developing hypertension is about 90 percent for men and women at age 55. About one in five Americans has high blood pressure and about a third of them don't know they have it. High blood pressure contributed to about 118,000 deaths in 2000....

Panel of leading neurologists pronounce best treatment for Guillain-Barr Syndrome

...disorder that typically affects patients once in a lifetime but may cause severe lifelong disability. An expert group from the American Academy of Neurology will publish this and other treatment recommendations for the syndrome in the September 23 issue of Neurology, www.neurology.org . "The bottom line he...

Abdominal fat, a contributor to heart disease risk, is related to alcohol drinking pattern

...th or without food. Categories of frequency were: lifetime abstainers, non-current drinkers (did not consume alcohol during the past 30 days) and current drinkers (consumed a least one alcoholic beverage during the past 30 days). Current drinkers were broken down into daily, weekly and less-than-weekly drin...

Other highlights in the August 20 issue of JNCI

...e findings are compatible with the hypothesis that lifetime risk of testicular cancer is determined early in life, possible before birth," the authors conclude. Study Reevaluates Role of Carcinogen-Activating Enzyme Previous studies in cell cultures suggested that the enzyme CYP12A activates metabolites ...

Vaccine development sparks debate on changes to cervical cancer screening guidelines

...earchers used a mathematical model to estimate the lifetime costs and life expectancy of three screening strategies: vaccination only conventional screening only, and vaccination followed by screening. In the two screening strategies, intervals of one, two and five years, with starting ages of 18, 22, 24 ...

1 2 3 4 5 6 7 8 9

(Date:8/29/2014)... Pursuing its deepest desires to help build ... stunning new design that promises to redefine the global ... surrogacy platform has witnessed a 42 percent increase in ... month, the FindSurrogateMother.com community is formed by hopeful parents ... — the precious gift of life. , Whether intended ...
(Date:8/29/2014)... News) -- If you have bunions, taking care of them ... expert says. A bunion is a bump that forms ... tissue moves out of place and extends beyond the normal ... pain and may require surgery to correct, said Brent Rosenthal, ... Freehold, N.J. To prevent bunions, avoid wearing shoes with ...
(Date:8/29/2014)... NEW YORK August 29, 2014 - Despite US ... obesity, there are many barriers, several of which may ... study by researchers at NYU Langone Medical Center published ... General Internal Medicine ( JGIM ). , David ... Department of Internal Medicine at NYU Langone, and colleagues ...
(Date:8/29/2014)... AURORA, Colo. (Sept. 2, 2014) A team of ... has reported the breakthrough discovery of a process to ... patients. These findings could have implications that extend beyond ... and autoimmune diseases., In an article published ... the Charles C. Gates Center for Regenerative Medicine and ...
(Date:8/29/2014)... 29, 2014 Today, NBC’s “The ... who profiled a handful of safe, back to ... Research. This year, many schools will include earphones ... innovator of hearing wellness solutions, offers the best ... Earphones, offered in yellow, pink and black, sound ...
Breaking Medicine News(10 mins):Health News:FindSurrogateMother.com Set to Unveil Stunning New Design as Member Sign-ups Increase by 42% since January 2Health News:FindSurrogateMother.com Set to Unveil Stunning New Design as Member Sign-ups Increase by 42% since January 3Health News:Take Steps to Control Bunions 2Health News:Options for weight loss your primary care doctor might not know about 2Health News:CU scientists' discovery could lead to new cancer treatment 2Health News:The Today Show Features ETY•Kids® Safe-Listening Earphones by Etymotic 2
Other Tags
hayfevershotantelopesaigakineticsilymarinplasticityinvasionsendocrineaaccmightdiscovereddefectataxiafriedreichreverses