Tag: "light" at medical news

Opportunity missed: TIA patients receive less aggressive attention than those with stroke

...percent versus 67 percent for stroke patients. In light of the findings, Dandapani recommended improved public education about TIA and stroke and improved diagnosis and therapy for TIA. Dandapani plans to extend this TIA research to different regions of the country and to different types of hospitals. A...

Stat5 protein inhibits spread of breast cancer cells

...ve role of Stat5 in breast cancer is surprising in light of the tumor promoting role that Stat5 appears to play in leukemias, lymphomas, and prostate cancer," said Rui. "On the other hand, the new data may not be so unexpected since Stat5 is known to promote differentiation of healthy breast cells. Differe...

New study finds kelp can reduce level of hormone related to breast cancer risk

...ed Feb. 2 in the Journal of Nutrition, shine a new light onto the Japanese diet. Prior studies have shown that Japanese women have longer menstrual cycles and lower serum estradiol levels than their Western counterparts, which researchers say may contribute to their lower rates of breast, endometrial and o...

Rat whisking may provide insight into debilitating eye disorder

..., the blinking reflex protects the eye from bright light and other environmental hazards, but in blepharospasm this blinking response gets out of control. The resulting muscle spasms can be so intense that the eyelids remain forcefully closed for several hours at a time. "The human eyeblink reflex circ...

Inflammatory cells highly promising target in NF 1

...lifetime. Some NF 1 patients also develop numerous light brown (caf-au-lait) spots on the skin, enlargement and deformation of bones and curvature of the spine (scoliosis), and in many instances, learning disorders. Occasionally, tumors may develop in the brain, on cranial nerves, or on the spinal cord. Ho...

Smoking hurts wealth as well as health, study suggests

...et worth is roughly 50 percent higher than that of light smokers and about twice the level of that of heavy...sues, including smoking and wealth. In this study, light smokers were defined as those who reported smoking less than a pack a day on average, while heavy sm...

Treatment for brain tumor does not always follow recommendations

...rogeneous group of tumors lumped together based on light microscopy. Some treatments may be highly beneficial to a select few patients, yet ineffective in many others. At the same time, phase 1 trials in oncology that have traditionally excluded patients with brain tumors should be made more widely availab...

Two studies find evidence that sunlight may have beneficial influence on cancer

... results suggest an inverse association between UV light exposure and non-Hodgkin lymphoma risk," Smedby and colleagues write. "However, before this association can be considered causal we need further confirmatory data from other epidemiologic studies and, ideally, a better understanding of possible biolo...

Infection in breast implants

...ction of breast implants is particularly timely in light of the recent call for tighter regulation of the private cosmetic surgery industry in the UK. Professor Brigitte Pittet (Plastic and Reconstructive Surgery Unit, University of Geneva Hospitals, Geneva, Switzerland) and colleagues provide a fascinatin...

Wine drinkers live longer than beer guzzlers

...e agreement among researchers that any alcohol, in light to moderate intake, puts drinkers at lower risk for cardiovascular disease and death than non-drinkers. "It is also known from a number of studies that wine drinkers in many cultures are from a higher socio-economic status and have a better diet than...

New non-hormonal hot flash treatment set for clinical trial

... therapy, or HRT, but more information has come to light showing that HRT might have some dangerous side effects. "Since there were not many non-hormonal hot flash therapies available, and because the number of women with hot flashes is so large -- about 30 million women in the U.S. -- the University of R...

Views from space help oil prospectors see deep underground

... of a map of coupling potential. Visible light images provide infrastructure and land use informa... The ground reflects short-wave infrared (SWIR) light immediately, revealing the spectral characteristics of minerals at the surface. SWIR imagery, obtain...

Rice scientist recognized as pioneer in tissue engineering

...uid at the site of an injury, and it is exposed to light or other chemicals that cause it to harden within a few minutes. Once the material sets, it acts as an immediate aid in the body's efforts to form new tissue and heal itself. In developing its scaffolding materials, Mikos' group has focused on chemic...

Vaginal hysterectomy leads to better outcomes than abdominal surgery

...cided by a woman in discussion with her surgeon in light of the relative benefits and hazards," he adds. The review appears in the January issue of The Cochrane Library, a publication of The Cochrane Collaboration, an international organization that evaluates medical research. Systematic reviews draw evide...

Common antidepressants lower effects of tamoxifen in many women

...oxifen and its active metabolites. "We can see the light at the end of the tunnel," said Dr. Flockhart. "Using our pharmacogenetic tool kit, we are very close to being able to identify which women should be given which drug to treat her depression or hot flashes."...

PENN study emphasizes need for national guidelines for assisted reproductive technology programs

...of Pennsylvania School of Medicine sheds important light on the values that govern access to ART. The study, published in the January 2005 issue of the journal Fertility and Sterility, reveals an alarming inconsistency in the candidate-screening practices of different ART programs in the United States. In...

2001-2002 survey finds that many recover from alcoholism

...ering the first stage of followup that should shed light on pathways to recovery....

AGI and USGS provide unique tsunami disaster relief

ALEXANDRIA, VA In light of the recent tsunami disaster in Indonesia and other parts of Asia, the U.S. Geological Survey (USGS), in cooperation with the American Geological Institute (AGI), is providing copies of the Global GIS DVD-ROM to U.S. Department of State-led teams t...

Authors warn of inaccuracies concerning use of race in health & social science research

... and scientifically sound way, particularly in the light of advances in knowledge due to the Human Genome Project. The question is raised as to whether self-identified race variables, specifically in genetics analyses, should be discarded altogether. Alexandra Shields, PhD (Georgetown University), and her...

Entrepreneurism Center at UC San Diego funds commercialization of lung, shock, other devices

...ignaling, traffic lights, automobile lights. White light from LEDs would offer many advantages for general lighting: reduced electrical energy consumption, reduced carbon-related pollution, increased lifetime, and so on. There are numerous research approaches to the problem, especially the best materials ...

1 2 3 4 5 6 7 8 9 10

(Date:5/18/2013)... Family Magazine of Washington DC was awarded the "Best ... Inc. in the category of Summer Camps in DC ... the areas best in the ultimate guide on parenting, kids ... Brenda Hyde, a mother of four and publisher of Family ... vast resources available to them in the DC Metro area. ...
(Date:5/18/2013)... (PRWEB) May 18, 2013 During Better ... loss should consider the legal protections they have, including ... problems arise with their child’s treatment or hearing aid ... Since 1927, the American Speech-Language-Hearing Association has used the ... and to promote treatment, such as cochlear implants, which ...
(Date:5/18/2013)... 18, 2013 Simple changes in a ... snacks and drinking more water can lead to substantial ... a healthier lifestyle overall. Diet Doc understands ... weight loss can be difficult and often requires the ... plans to help patients get over initial weight loss ...
(Date:5/18/2013)... 2013 6Webs.com is the leader in ... reviews and comprehensive comparisons make 6Webs.com the useful resource ... 6Webs.com just recently finished conducting their assessments of the ... Smythe from 6Webs.com reports, "There has been an increase ... ease of use, expandability and mobility. Combine these features ...
(Date:5/18/2013)... Show And Go Training, the culmination of ... systems that is all about is getting results in the ... http://ShowAndGoTrainingReview.com ’s Stan Stevenson, prompting an investigative review. ... “four phase system” designed to make you faster, stronger, fitter ... working out in the gym. The training manual and exercise ...
Breaking Medicine News(10 mins):Health News:Summer Camps in DC "Best of the Best" Awarded to Family Magazine of Washington DC for Excellence by Follow Media Consulting, Inc. 2Health News:Schachter, Hendy & Johnson PSC Lawyer Says Cochlear Implant Victims Should Know Their Legal Rights 2Health News:Schachter, Hendy & Johnson PSC Lawyer Says Cochlear Implant Victims Should Know Their Legal Rights 3Health News:hCGTreatments / Diet Doc hCG Diets & Weight Loss Plans Announce the Best Weight Loss Through New Whole Foods, Healthy Snacks and Prescription Strength hCG Treatments 2Health News:hCGTreatments / Diet Doc hCG Diets & Weight Loss Plans Announce the Best Weight Loss Through New Whole Foods, Healthy Snacks and Prescription Strength hCG Treatments 3Health News:Best Wireless Home Security System Companies Released by 6Webs.com 2Health News:Show And Go Training: Review Examining Eric Cressy's Workout Program Revealed 2
Other Tags
sarawakmalaysianweevilnicetrendupwardpredisposingemphasiscouricmovieadvisestraymitigatesolicitousnessgastroenteritisgatorade