Tag: "look" at medical news

Grant to study why teens smoke

...itute for Health Research and Policy. "We will look at the combined social, emotional and physiologica...ce teen smoking behaviors. The researchers will look at adolescent smoking patterns and predictors including emotional well-being, daily activities, soci...

Rice engineers demo first T-ray endoscope

...r engineering. "Wave guide technology frees you to look around corners and get into tight places." Teraher...security applications, developing systems that can look inside people's shoes, bags and clothing for guns, bombs and contraband. T-rays lie between microwav...

To weigh less, eat more

...Martin says, "This is the first long-term study to look at how a low energy density diet can affect body weight. It's important because it shows that a healthy diet pattern can result in significant weight loss without couting calories or fat grams." Ello-Martin's co-authors are Liane Roe, research nutri...

All chronic sinusitis is not created equal, study finds

...in some basic science as they took a retrospective look at 55 patients who had surgery for their disease a... simple blood test. "Then, as we design studies to look for still better treatments, we can use this information to compare apples to apples," says Dr. Koun...

Top 10 toys for children with ADHD

...States. Remove distractions. Does your playroom look like a toy store? Children with ADHD are easily distracted when there are lots of toys around vying for their attention. To help your child focus, it might be helpful to have a play table where only one game or toy can be played with at a time. Pl...

Post-therapy damage in medulloblastoma patients can be mistaken for new tumors

...can cause changes in the brain's white matter that look like tumors when seen on MRI scans. This finding, by a team of investigators led by St. Jude Children's Research Hospital, is published in the Nov. 15 issue of Journal of Clinical Oncology (JCO). White matter is the part of the brain composed of n...

Chemoprevention backgrounder: Working for a future of cancer chemoprevention

...y apparent. M. D. Anderson was among the first to look for agents that may help prevent cancer - some thr...ccurrence, because of time constraints, but rather look at the incidence of adenomatous (glandular) polyps, which are known to increase colon cancer risk. B...

Studies from the November issue of The Archives of Dermatology, a theme issue on facial rejuvenation

... passed over the surface of the skin, improves the look of skin that has been damaged by the sun. The study, involving 28 patients aged 48 to 78 years old, found that the laser resurfacing produced changes in the skin's composition and that it was "clearly efficacious in producing cosmetic improvements i...

'Birth control pill may reduce knee injury': McGill researchers

...composition. Based on these studies, we decided to look at the effect of oral contraception on knee ligaments. Our long-term goal was to find treatment for those athletes at risk." Martineau and his research team assessed the knee stability of 78 female athletes 42 who were taking the pill and 36 who wer...

Proposed addiction treatment successful, safe in second small trial

...field of vision. The current study was designed to look for such visual side effects while testing the efficacy of a relatively low GVG dose. In response to word-of-mouth and newspaper-ad recruitment, 30 patients enrolled in the study. All had abused methamphetamine and/or cocaine daily for a mean durati...

New WHO study asks, 'How happy are you with your lot in life?'

...of how they perceive their own quality of life and look for areas where they can redress any unbalance that may exist." The survey questionnaire the WHOQOL - has been developed over the last decade through a collaboration of researchers and clinicians with focus groups of users throughout the world...

Good intentions versus bad habits: Why the old ways win out

... their study, the researchers sought to take a new look at why old habits seem to prevail over our attempts to change our behavior. Their findings suggest that even though the strength of an old habit may fade over time, our memory for it will be stronger then any new good intentions that succeed it. ...

Satellite view highlights Europe's changing landscape

...elds of motorway is constructed in Europe. If you look at this development over a 50-year span you will see dramatic consequences for example for wildlife. "One has to take into account that once this fragmentation of the landscape has happened, the situation is practically irreversible. Some countries ...

Study looks at ACTOS' effects on blood lipids in people with type 2 diabetes

...s of this study may suggest that physicians should look beyond the glycemic effects of these drugs to their potential lipid-altering effects in people with type 2 diabetes. ************** INTERVIEW OPPORTUNITIES AVAILABLE**************** WHO: Ronald B. Goldberg, M.D., Professor of Medicine, Associate ...

Women with arrhythmias may also benefit from an ICD

... Ill. "We were concerned about that and wanted to look more closely. What we found is that ICD placement...andard therapy died. The study was not designed to look at men and women separately. However, there is strong "confirmatory evidence that the ICD should be...

News tips for Tuesday, November 9, 2004

... and not-so-good news. Researchers taking a fresh look at behavioral factors affecting cardiovascular disease risk find one trend that's good, and another that's decidedly not. A comparison of data from two large national health surveys (NHANES 1999-2000 and NHANES III) shows that smoking prevalence has...

Brookhaven Lab and BioSET develop a synthetic peptide that enhances the effect of BMP-2

... aimed at replicating human growth factors, and we look forward to further validating the potential of these peptides to enhance the body's healing capacity, especially when combined with orthopedic implants." He added, "We believe the future of orthopedics will continue evolvi...

News tips for Sunday, November 7, 2004

...king in women and 8 percent in men. In a separate look at marital status, married men were 5 percent less likely to be hypertensive, and they were more likely to have lower systolic pressures, cholesterol levels and body mass indices. Married women also had significantly lower cholesterol and body mass ...

Study: Physical activity in middle age cuts risk of early death

... even light exercise, but this study allowed us to look across different population groups, and different levels of cardiovascular risk, and see who got the most 'punch' out of exercise," says lead author Caroline Richardson, M.D., an assistant professor of family medicine at the U-M who performed the stu...

Emory cardiologists present research at AHA scientific sessions in New Orleans, Nov. 7 - 10

...ions in the future. Emory Heart Center physicians look forward to participating in this comprehensive cardiovascular educational event that plays such a significant role in presenting new heart research and important programs and panels on clinical care issues, "says Douglas C. Morris, M.D., Dir...

1 2 3 4 5 6 7 8 9 10

(Date:5/18/2013)... May 18, 2013 Spectrum Surgical ... on May 17-22 in Austin, TX where thousands ... educational and networking opportunities. , Spectrum Surgical/STERIS ... flexible scope repair capabilities and certified pre-owned ... educational information on proper instrument care of flexible ...
(Date:5/18/2013)... Irvine CA (PRWEB) May 18, 2013 The ... Scrum classes are scrum framework, scrum roles, scrum meetings, scrum ... development units (8 PDUs) for attending them. , These trainings ... directors. It is also ideal for those who will be ... industry or those who want to explore Agile and Scrum, ...
(Date:5/18/2013)... Wine World Accessories, a renowned online ... an attractive 25% discount on Franmara Dynamo Electric ... now purchase this electric corkscrew opener for $44.95 via ... The online store ensures delivery of their items within ... , A spokesperson from the online store elaborates ...
(Date:5/18/2013)... CA (PRWEB) May 18, 2013 ... latest update to consumers about transvaginal mesh ... federal court Resource4thePeople reports that plaintiffs have ... to court documents. , The rulings came ... District Court in the Southern District of ...
(Date:5/18/2013)... 2013 Medical device company, FlexLeg, LLC, last ... anticipated mobility aid with its namesake, the FlexLeg. The ... crutch alternative that injured individuals can use to walk ... can remain active and walk during a typical 6-8 week ... system to ensure those who need the device most are ...
Breaking Medicine News(10 mins):Health News:Spectrum Surgical Attends Society of Gastroenterology Nurses and Associates' (SGNA) 40th Annual Conference in Austin, TX 2Health News:Affordable Scrum Trainings In Irvine by Conscires Agile Practices 2Health News:Affordable Scrum Trainings In Irvine by Conscires Agile Practices 3Health News:Now Save 25% on Franmara Dynamo Electric Wine Bottle Opener at Wine World Accessories 2Health News:2013 Alleged Transvaginal Mesh Complications Lawsuits Update: Resource4thePeople Reports Defendants Ordered to Provide Testimony, Documents 2Health News:2013 Alleged Transvaginal Mesh Complications Lawsuits Update: Resource4thePeople Reports Defendants Ordered to Provide Testimony, Documents 3Health News:2013 Alleged Transvaginal Mesh Complications Lawsuits Update: Resource4thePeople Reports Defendants Ordered to Provide Testimony, Documents 4Health News:FlexLeg Begins Offering New Mobility Aid 2
Other Tags
naturetoldentrepreneursrepellentsfiringmixesriboswitchespeekscryingnighttimechronicinfantsmaasiowacabonathan